Description

  • Product name

    Recombinant Human CstF-64 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAGLTVRDPAVDRSLRSVFVGNIPYEATEGQLKDIFSEVGPVVSFRLVYD RETGKPKGYGFCEYQDQETALNAMRNLNGREFSGRALRVDNAASEKNKEE LKSLGTGAPVIESPYGETISPEDAPESISKAVASLPPEQMFELMKQMKLC VQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHRQTNIPTL IAGNPQPVHGAGPGSGSNVSMNQQNPQAPQAQSLGGMHVNGAPPLMQASM QGGVPAPGQMPAAVTGPGPGSLAPGGGMQAQVGMPGSGPVSMERGQVPMQ DPRAAMQRGSLPANVPTPRGLLGDAPNDPRGGTLLSVTGEVEPRGYLGPP HQGPPMHHVPGHESRGPPPHELRGGPLPEPRPLMAEPRGPMLDQRGPPLD GRGGRDPRGIDARGMEARAMEARGLDARGLEARAMEARAMEARAMEARAM EARAMEVRGMEARGMDTRGPVPGPRGPIPSGMQGPSPINMGAVVPQGSRQ VPVMQGTGMQGASIQGGSQPGGFSPGQNQVTPQDHEKAALIMQVLQLTAD QIAMLPPEQRQSILILKEQIQKSTGAP
    • Amino acids

      1 to 577
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158223 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • betaCstF 64 variant 2
    • CF-1 64 kDa subunit
    • CF1 64 kDa subunit
    • Cleavage stimulation factor 2
    • Cleavage stimulation factor 64 kDa subunit
    • Cleavage stimulation factor subunit 2
    • Cleavage stimulation factor, 3' pre RNA, subunit 2, 64kDa
    • CSTF 2
    • CstF 64
    • CSTF 64 kDa subunit
    • CstF-64
    • CSTF2
    • CSTF2_HUMAN
    • MGC188397
    see all
  • Function

    One of the multiple factors required for polyadenylation and 3'-end cleavage of mammalian pre-mRNAs. This subunit is directly involved in the binding to pre-mRNAs.
  • Sequence similarities

    Contains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus. Localized with DDX1 in cleavage bodies.
  • Information by UniProt

Images

  • ab158223 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158223 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158223.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up