Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQL QGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLL DAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPR AEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
    • Molecular weight

      21 kDa
    • Amino acids

      2 to 201

Specifications

Our Abpromise guarantee covers the use of ab134868 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured in a cell proliferation assay using TF-1 Human erythroleukemic cells. The ED50 for this effect is typically 0.25 – 0.85 ng/ml.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    ab134868 was constructed as a fusion protein and was highly purified using affinity matrix from E. coli. After specific proteinase cleavage, native CT-1 protein was collected and suspended in PBS buffer.
  • Form

    Liquid
  • Additional notes

    Previously labelled as Cardiotrophin 1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Constituent: 99% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Cardiophin 1
    • Cardiophin1
    • Cardiotrophin I
    • Cardiotrophin-1
    • Cardiotrophin1
    • CardiotrophinI
    • CT 1
    • CT-1
    • CT1
    • CTF 1
    • Ctf1
    • CTF1_HUMAN
    see all
  • Function

    Induces cardiac myocyte hypertrophy in vitro. Binds to and activates the ILST/gp130 receptor.
  • Tissue specificity

    Highly expressed in heart, skeletal muscle, prostate and ovary. Lower levels in lung, kidney, pancreas, thymus, testis and small intestine. Little or no expression in brain, placenta, liver, spleen, colon or peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the IL-6 superfamily.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab134868 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134868.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up