Description

  • Product name

    Recombinant Human CT-1 protein (Tagged-His Tag)
    See all CT-1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    The purity of ab192279 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNHKVHHHHHHMSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTK YAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRL DAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEAL LAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTE GDLGQLLPGGSA
    • Predicted molecular weight

      23 kDa including tags
    • Amino acids

      1 to 201
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab192279 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

    Previously labelled as Cardiotrophin 1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

  • Reconstitution
    Dissolve protein in 1 x PBS to a concentration no less than 100ug/ml

General Info

  • Alternative names

    • Cardiophin 1
    • Cardiophin1
    • Cardiotrophin I
    • Cardiotrophin-1
    • Cardiotrophin1
    • CardiotrophinI
    • CT 1
    • CT-1
    • CT1
    • CTF 1
    • Ctf1
    • CTF1_HUMAN
    see all
  • Function

    Induces cardiac myocyte hypertrophy in vitro. Binds to and activates the ILST/gp130 receptor.
  • Tissue specificity

    Highly expressed in heart, skeletal muscle, prostate and ovary. Lower levels in lung, kidney, pancreas, thymus, testis and small intestine. Little or no expression in brain, placenta, liver, spleen, colon or peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the IL-6 superfamily.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab192279 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192279.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up