Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      NEKRYRFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEEKSREF IGNFLELFGPDGAWKQMFQERSSRMLQAL
    • Amino acids

      236 to 314
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160501 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as PCYT1B.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CCT B
    • CCT beta
    • CCT-beta
    • CCTB
    • CCTbeta
    • choline-phosphate cytidylyltransferase B
    • CT B
    • CTB
    • CTP:phosphocholine cytidylyltransferase B
    • OTTHUMP00000023085
    • PCYT1B
    • Phosphate cytidylyltransferase 1, choline, beta isoform
    • phosphate cytidylyltransferase1, choline, beta
    • Phosphorylcholine transferase B
    see all
  • Relevance

    CT B belongs to the cytidylyltransferase family. It controls phosphatidylcholine synthesis. PCYT1B is highly expressed in testis, placenta, brain, ovary and fetus. Several alternatively spliced transcript variants encoding three isoforms have been found for this gene.
  • Cellular localization

    Endoplasmic reticulum.

Images

  • ab160501 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160501 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160501.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up