Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDGPAIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCF RDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDYGKKCVVI DLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQL FECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRL GRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLS REDDVYSMLHRLCNR
    • Molecular weight

      56 kDa including tags
    • Amino acids

      1 to 265

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132859 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C3orf8
    • Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 3
    • CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like
    • CTD small phosphatase-like protein
    • CTDSL_HUMAN
    • CTDSP-like
    • Ctdspl
    • hYA22
    • N-like protein
    • NIF-like protein
    • NLI-interacting factor 1
    • Nuclear LIM interactor-interacting factor 1
    • Protein YA22
    • RB protein serine phosphatase from chromosome 3
    • RBSP3
    • SCP3
    • Small C-terminal domain phosphatase 3
    • Small CTD phosphatase 3
    see all
  • Function

    Preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residues repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A. Negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation (By similarity). Recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells.
  • Tissue specificity

    Expression is restricted to non-neuronal tissues.
  • Sequence similarities

    Contains 1 FCP1 homology domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132859 stained with Coomassie Blue.

References

ab132859 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132859.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up