Overview

  • Product name

    Recombinant Human CTDSPL2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MRLRTRKASQQSNQIQTQRTARAKRKYSEVDDSLPSGGEKPSKNETGLLS SIKKFIKGSTPKEERENPSKRSRIERDIDNNLITSTPRAGEKPNKQISRV RRKSQVNGEAGSYEMTNQHVKQNGKLEDNPSSGSPPRTTLLGTIFSPVFN FFSPANKNGTSGSDSPGQAVEAEEIVKQLDMEQVDEITTSTTTSTNGAAY SNQAVQVRPSLNNGLEEAEETVNRDIPPLTAPVTPDSGYSSAHAEATYEE DWEVFDPYYFIKHVPPLTEEQLNRKPALPLKTRSTPEFSLVLDLDETLVH CSLNELEDAALTFPVLFQDVIYQVYVRLRPFFREFLERMSQMYEIILFTA SKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIKDLNILGRDLSKT IIIDNSPQAFAYQLSNGIPIESWFMDKNDNELLKLIPFLEKLVELNEDVR PHIRDRFRLHDLLPPD
    • Amino acids

      1 to 466
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162575 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase like 2
    • CTD small phosphatase like 2
    • CTD small phosphatase like protein 2
    • CTD small phosphatase-like protein 2
    • CTDSP like 2
    • CTDSP-like 2
    • ctdspl2
    • CTSL2_HUMAN
    • HSPC058
    • HSPC129
    see all
  • Function

    Probable phosphatase.
  • Sequence similarities

    Belongs to the CTDSPL2 family.
    Contains 1 FCP1 homology domain.
  • Information by UniProt

Images

  • ab162575 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162575 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162575.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up