Description

  • Product name

    Recombinant Human CTF18 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GVHRPAPRNHEQRLEHIMRRAAREEQPEKDFFGRVVVRSTAVPSAGDTAP EQDSVERRMGTAVGRSEVWFRFNEGVSNAVRRSLYIRDLL
    • Amino acids

      886 to 975
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163755 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as CHTF18. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 6030457M03Rik
    • C16orf41
    • C321D2.2
    • C321D2.3
    • C321D2.4
    • CHL12
    • chromosome transmission fidelity factor 18 homolog (S. cerevisiae)
    • Chromosome transmission fidelity protein 18 homolog
    • chtf18
    • Ctf18
    • CTF18_HUMAN
    • hCTF18
    • MGC38008
    • RUVBL
    see all
  • Function

    Chromosome cohesion factor involved in sister chromatid cohesion and fidelity of chromosome transmission. Component of one of the cell nuclear antigen loader complexes, CTF18-replication factor C (CTF18-RFC), which consists of CTF18, CTF8, DCC1, RFC2, RFC3, RFC4 and RFC5. The CTF18-RFC complex binds to single-stranded and primed DNAs and has weak ATPase activity that is stimulated by the presence of primed DNA, replication protein A (RPA) and by proliferating cell nuclear antigen (PCNA). The CTF18-RFC complex catalyzes the ATP-dependent loading of PCNA onto primed and gapped DNA. It also interacts with and stimulates DNA polymerase POLH.
  • Sequence similarities

    Belongs to the activator 1 small subunits family. CTF18 subfamily.
  • Cellular localization

    Nucleus. Associates with chromatin during S phase.
  • Information by UniProt

Images

  • ab163755 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163755 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163755.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up