Recombinant human CTGF protein (ab50044)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human CTGF protein
See all CTGF proteins and peptides -
Biological activity
Biological Activity : Determined by the dose-dependent stimulation of the proliferation of HUVEC cells. The expected ED50 for this effect is 1.0-2.0 µg/ml.
-
Purity
> 95 % SDS-PAGE.
Endotoxin level is less than 0.1 ng per µg (1EU/µg). -
Expression system
Escherichia coli -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLP VEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA -
Predicted molecular weight
11 kDa -
Amino acids
253 to 349
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab50044 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionFor lot specific reconstitution information please contact our Scientific Support Team.
General Info
-
Alternative names
- CCN 2
- CCN family member 2
- CCN2
see all -
Function
Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis. -
Tissue specificity
Expressed in bone marrow and thymic cells. Also expressed one of two Wilms tumors tested. -
Sequence similarities
Belongs to the CCN family.
Contains 1 CTCK (C-terminal cystine knot-like) domain.
Contains 1 IGFBP N-terminal domain.
Contains 1 TSP type-1 domain.
Contains 1 VWFC domain. -
Cellular localization
Secreted > extracellular space > extracellular matrix. Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab50044 has not yet been referenced specifically in any publications.