For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-ctgf-protein-ab50044.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Angiogenesis Growth Factors Other
Share by email

Recombinant human CTGF protein (ab50044)

  • Datasheet
Submit a review Q&A (3)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 95% SDS-PAGE
  • Active: Yes
  • Suitable for: SDS-PAGE, Functional Studies

You may also be interested in

ELISA
Product image
Human CTGF ELISA kit (ab261851)
Pair
Product image
Human CTGF Antibody Pair - BSA and Azide free (ab270348)

View more associated products

Description

  • Product name

    Recombinant human CTGF protein
    See all CTGF proteins and peptides
  • Biological activity

    Biological Activity : Determined by the dose-dependent stimulation of the proliferation of HUVEC cells. The expected ED50 for this effect is 1.0-2.0 µg/ml.

  • Purity

    > 95 % SDS-PAGE.
    Endotoxin level is less than 0.1 ng per µg (1EU/µg).
  • Expression system

    Escherichia coli
  • Accession

    P29279
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLP VEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
    • Predicted molecular weight

      11 kDa
    • Amino acids

      253 to 349

Associated products

  • Related Products

    • Anti-CTGF antibody (ab6992)

Specifications

Our Abpromise guarantee covers the use of ab50044 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilized
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    For lot specific reconstitution information please contact our Scientific Support Team.

General Info

  • Alternative names

    • CCN 2
    • CCN family member 2
    • CCN2
    • Connective tissue growth factor
    • Ctgf
    • CTGF_HUMAN
    • Hcs 24
    • Hcs24
    • Hypertrophic chondrocyte specific protein 24
    • Hypertrophic chondrocyte-specific gene product 24
    • Hypertrophic chondrocyte-specific protein 24
    • IBP-8
    • IGF-binding protein 8
    • IGFBP-8
    • IGFBP8
    • Insulin like Growth Factor Binding Protein 8
    • Insulin-like growth factor-binding protein 8
    • MGC102839
    • NOV 2
    • NOV2
    see all
  • Function

    Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis.
  • Tissue specificity

    Expressed in bone marrow and thymic cells. Also expressed one of two Wilms tumors tested.
  • Sequence similarities

    Belongs to the CCN family.
    Contains 1 CTCK (C-terminal cystine knot-like) domain.
    Contains 1 IGFBP N-terminal domain.
    Contains 1 TSP type-1 domain.
    Contains 1 VWFC domain.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix. Secreted.
  • Target information above from: UniProt accession P29279 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab50044? Please let us know so that we can cite the reference in this datasheet.

    ab50044 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-3 of 3 Abreviews or Q&A

    Question

    Customer kindly asked the positive control protein they can use with ab109606 and ab84244.

    Read More

    Abcam community

    Verified customer

    Asked on Feb 06 2012

    Answer

    Thank you for contacting us.

    I can confirm that ab50044 can be used as a control in sELISA involving ab84244 and ab109606.

    Please be advised the conditions and dilutions has to be determined by end use.

    I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

    Read More

    Abcam Scientific Support

    Answered on Feb 06 2012

    Question

    I am sorry that I don’t catch your meaning exactly. Do you means the two products can both use to promote the cell’s Proliferation or adhesion? Or they have different use because “they are different fragments of the CTGF”?   Thank you very much for your reply! --

    Read More

    Abcam community

    Verified customer

    Asked on Nov 03 2011

    Answer

    My previous statement was incorrect. These, ab50044 and ab61847, appear to be the same fragment, but it is not clear to me if both products have both been assayed for activity. Only the ab50044 datasheet includes a note about stimulation of HUVEC proliferation. We are not aware of any testing of stimulation of fibroblast proliferation. Here are links to the two datasheets for ab50044 and ab61847: Click here (or use the following: https://www.abcam.com/Recombinant-human-CTGF-protein-ab50044.html). Click here (or use the following: https://www.abcam.com/CTGF-protein-Active-ab61847.html). From the ab50044 datasheet: Recombinant fragment, corresponding to amino acids 253-350 of Human CTGF, a 11.2 kDa protein of 98 amino acid residues which exerts full heparin binding, cell adhesion, and mitogenic CTGF activity. Biological Activity : Determined by the dose-dependent stimulation of the proliferation of HUVEC cells. The expected ED50 for this effect is 1.0-2.0 µg/ml. Farther down on the datasheet, the sequence is specified: MGKKCIRTPK ISKPIKFELS GCTSMKTYRA KFCGVCTDGR CCTPHRTTTL PVEFKCPDGE VMKKNMMFIK TCACHYNCPG DNDIFESLYY RKMYGDMA From the ab61847 datasheet: Recombinant C-terminal fragment (Human) containing 98AA. MW: 11.2 kDa. MGKKCIRTPK ISKPIKFELS GCTSMKTYRA KFCGVCTDGR CCTPHRTTTL PVEFKCPDGE VMKKNMMFIK TCACHYNCPG DNDIFESLYY RKMYGDMA These are actually the same fragment, though only the ab50044 datasheet has the note about activity testing. I know this may not answer all your questions; please reply if you need more infomation.

    Read More

    Abcam Scientific Support

    Answered on Nov 04 2011

    Question

    Thank you very much for your reply!   Do you mean the "CTGF fragment ab69786" is just use in western blotting, and it doesn't have activity to promote the function of the fibroblasts? Do you think ab61847 and ab50044 are suitable for my research purpose? I have seen that the ab61847 and ab50044 are for "SDS-PAGE ". Which is the difference between the two products?

    Read More

    Abcam community

    Verified customer

    Asked on Oct 31 2011

    Answer

    The protein ab69786 has not, to our knowledge, been tested for activity. The other two are the same fragment, different from the ab69786 fragment, and both appear to have been tested for activity, though only the ab50044 datasheet mentions the testing and lists functional assays as an applicaton. Please let me know if you have other questions.

    Read More

    Abcam Scientific Support

    Answered on Oct 31 2011

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.