Recombinant human CTGF protein (ab50044)

Submit an Abreview Q&A (3)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
      P29279
    • Species
      Human
    • Sequence
      GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLP VEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
    • Molecular weight
      11 kDa
    • Amino acids
      253 to 349

Associated products

Specifications

Our Abpromise guarantee covers the use of ab50044 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Biological Activity : Determined by the dose-dependent stimulation of the proliferation of HUVEC cells. The expected ED50 for this effect is 1.0-2.0 µg/ml.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    > 95 % SDS-PAGE.
    Endotoxin level is less than 0.1 ng per µg (1EU/µg).
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    Spin down vial and reconstitute in distilled water for a concentration of 0.1 - 1.0 mg/ml.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • CCN 2
    • CCN family member 2
    • CCN2
    • Connective tissue growth factor
    • Ctgf
    • CTGF_HUMAN
    • Hcs 24
    • Hcs24
    • Hypertrophic chondrocyte specific protein 24
    • Hypertrophic chondrocyte-specific gene product 24
    • Hypertrophic chondrocyte-specific protein 24
    • IBP-8
    • IGF-binding protein 8
    • IGFBP-8
    • IGFBP8
    • Insulin like Growth Factor Binding Protein 8
    • Insulin-like growth factor-binding protein 8
    • MGC102839
    • NOV 2
    • NOV2
    see all
  • Function
    Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis.
  • Tissue specificity
    Expressed in bone marrow and thymic cells. Also expressed one of two Wilms tumors tested.
  • Sequence similarities
    Belongs to the CCN family.
    Contains 1 CTCK (C-terminal cystine knot-like) domain.
    Contains 1 IGFBP N-terminal domain.
    Contains 1 TSP type-1 domain.
    Contains 1 VWFC domain.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix. Secreted.
  • Information by UniProt

References

ab50044 has not yet been referenced specifically in any publications.

Publishing research using ab50044? Please let us know so that we can cite the reference in this datasheet.

Customer reviews and Q&As

Submit a review Submit a question

3 reviews or Q&A

10
Votes: Highest First

Customer kindly asked the positive control protein they can use with ab109606 and ab84244.

Thank you for contacting us.

I can confirm that ab50044 can be used as a control in sELISA involving ab84244 and ab109606.

Please be advised the conditions and dilutions has to be determined by end use.

I hope this infor...

Read More

I am sorry that I don’t catch your meaning exactly. Do you means the two products can both use to promote the cell’s Proliferation or adhesion? Or they have different use because “they are different fragments of the CTGF”?   Thank you very much for you...

Read More

My previous statement was incorrect. These, ab50044 and ab61847, appear to be the same fragment, but it is not clear to me if both products have both been assayed for activity. Only the ab50044 datasheet includes a note about stimulation of HUVEC proli...

Read More

Thank you very much for your reply!   Do you mean the "CTGF fragment ab69786" is just use in western blotting, and it doesn't have activity to promote the function of the fibroblasts? Do you think ab61847 and ab50044 are suitable for my research purpos...

Read More

The protein ab69786 has not, to our knowledge, been tested for activity. The other two are the same fragment, different from the ab69786 fragment, and both appear to have been tested for activity, though only the ab50044 datasheet mentions the testing ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up