Recombinant human CTGF protein (ab50044)

Submit a review Q&A (3)

Description

  • Product name

    Recombinant human CTGF protein
    See all CTGF proteins and peptides

  • Biological activity

    Biological Activity : Determined by the dose-dependent stimulation of the proliferation of HUVEC cells. The expected ED50 for this effect is 1.0-2.0 µg/ml.

  • Purity

    > 95 % SDS-PAGE.
    Endotoxin level is less than 0.1 ng per µg (1EU/µg).

  • Expression system

    Escherichia coli

  • Accession

    P29279

  • Protein length

    Protein fragment

  • Animal free

    No

  • Nature

    Recombinant

    • Species

      Human

    • Sequence

      GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLP VEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA

    • Predicted molecular weight

      11 kDa

    • Amino acids

      253 to 349

Associated products

Specifications

Our Abpromise guarantee covers the use of ab50044 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    Spin down vial and reconstitute in distilled water for a concentration of 0.1 - 1.0 mg/ml.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    For lot specific reconstitution information please contact our Scientific Support Team.

General Info

  • Alternative names

    • CCN 2
    • CCN family member 2
    • CCN2
    • Connective tissue growth factor
    • Ctgf
    • CTGF_HUMAN
    • Hcs 24
    • Hcs24
    • Hypertrophic chondrocyte specific protein 24
    • Hypertrophic chondrocyte-specific gene product 24
    • Hypertrophic chondrocyte-specific protein 24
    • IBP-8
    • IGF-binding protein 8
    • IGFBP-8
    • IGFBP8
    • Insulin like Growth Factor Binding Protein 8
    • Insulin-like growth factor-binding protein 8
    • MGC102839
    • NOV 2
    • NOV2
    see all

  • Function

    Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis.

  • Tissue specificity

    Expressed in bone marrow and thymic cells. Also expressed one of two Wilms tumors tested.

  • Sequence similarities

    Belongs to the CCN family.
    Contains 1 CTCK (C-terminal cystine knot-like) domain.
    Contains 1 IGFBP N-terminal domain.
    Contains 1 TSP type-1 domain.
    Contains 1 VWFC domain.

  • Cellular localization

    Secreted > extracellular space > extracellular matrix. Secreted.
  • Information by UniProt

References

ab50044 has not yet been referenced specifically in any publications.

Publishing research using ab50044? Please let us know so that we can cite the reference in this datasheet.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

1-3 of 3 Abreviews or Q&A

Question

Customer kindly asked the positive control protein they can use with ab109606 and ab84244.

Read More
Answer

Thank you for contacting us.

I can confirm that ab50044 can be used as a control in sELISA involving ab84244 and ab109606.

Please be advised the conditions and dilutions has to be determined by end use.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Question

I am sorry that I don’t catch your meaning exactly. Do you means the two products can both use to promote the cell’s Proliferation or adhesion? Or they have different use because “they are different fragments of the CTGF”?   Thank you very much for your reply! --

Read More
Answer

My previous statement was incorrect. These, ab50044 and ab61847, appear to be the same fragment, but it is not clear to me if both products have both been assayed for activity. Only the ab50044 datasheet includes a note about stimulation of HUVEC proliferation. We are not aware of any testing of stimulation of fibroblast proliferation. Here are links to the two datasheets for ab50044 and ab61847: Click here (or use the following: https://www.abcam.com/index.html?datasheet=50044). Click here (or use the following: https://www.abcam.com/index.html?datasheet=61847). From the ab50044 datasheet: Recombinant fragment, corresponding to amino acids 253-350 of Human CTGF, a 11.2 kDa protein of 98 amino acid residues which exerts full heparin binding, cell adhesion, and mitogenic CTGF activity. Biological Activity : Determined by the dose-dependent stimulation of the proliferation of HUVEC cells. The expected ED50 for this effect is 1.0-2.0 µg/ml. Farther down on the datasheet, the sequence is specified: MGKKCIRTPK ISKPIKFELS GCTSMKTYRA KFCGVCTDGR CCTPHRTTTL PVEFKCPDGE VMKKNMMFIK TCACHYNCPG DNDIFESLYY RKMYGDMA From the ab61847 datasheet: Recombinant C-terminal fragment (Human) containing 98AA. MW: 11.2 kDa. MGKKCIRTPK ISKPIKFELS GCTSMKTYRA KFCGVCTDGR CCTPHRTTTL PVEFKCPDGE VMKKNMMFIK TCACHYNCPG DNDIFESLYY RKMYGDMA These are actually the same fragment, though only the ab50044 datasheet has the note about activity testing. I know this may not answer all your questions; please reply if you need more infomation.

Read More

Question

Thank you very much for your reply!   Do you mean the "CTGF fragment ab69786" is just use in western blotting, and it doesn't have activity to promote the function of the fibroblasts? Do you think ab61847 and ab50044 are suitable for my research purpose? I have seen that the ab61847 and ab50044 are for "SDS-PAGE ". Which is the difference between the two products?

Read More
Answer

The protein ab69786 has not, to our knowledge, been tested for activity. The other two are the same fragment, different from the ab69786 fragment, and both appear to have been tested for activity, though only the ab50044 datasheet mentions the testing and lists functional assays as an applicaton. Please let me know if you have other questions.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com