Description

  • Product name

    Recombinant Human CTGF protein (denatured)
    See all CTGF proteins and peptides
  • Purity

    > 85 % SDS-PAGE.
    ab202161 was purified by conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMQNCSGPCRCPDEPAPRCPAGVSLVLDGCG CCRVCAKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIF GGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVK LPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTE WSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVRPCEADLEENIKKGKK CIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEF KCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      27 to 349
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Mature protein without signal peptide. NP_001892 .
  • Description

    Recombinant Human CTGF protein

Specifications

Our Abpromise guarantee covers the use of ab202161 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • CCN 2
    • CCN family member 2
    • CCN2
    • Connective tissue growth factor
    • Ctgf
    • CTGF_HUMAN
    • Hcs 24
    • Hcs24
    • Hypertrophic chondrocyte specific protein 24
    • Hypertrophic chondrocyte-specific gene product 24
    • Hypertrophic chondrocyte-specific protein 24
    • IBP-8
    • IGF-binding protein 8
    • IGFBP-8
    • IGFBP8
    • Insulin like Growth Factor Binding Protein 8
    • Insulin-like growth factor-binding protein 8
    • MGC102839
    • NOV 2
    • NOV2
    see all
  • Function

    Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis.
  • Tissue specificity

    Expressed in bone marrow and thymic cells. Also expressed one of two Wilms tumors tested.
  • Sequence similarities

    Belongs to the CCN family.
    Contains 1 CTCK (C-terminal cystine knot-like) domain.
    Contains 1 IGFBP N-terminal domain.
    Contains 1 TSP type-1 domain.
    Contains 1 VWFC domain.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix. Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202161 (3µg).

References

ab202161 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202161.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up