Description

  • Product name

    Recombinant Human CTGF protein (His tag)
    See all CTGF proteins and peptides
  • Purity

    > 90 % Densitometry.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDP HKGLFCHFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTC LDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVG PALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNA SCRLEKQSRLCMVRPCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSM KTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACH YNCPGDNDIFESLYYRKMYGDMAHHHHHH
    • Predicted molecular weight

      36 kDa including tags
    • Amino acids

      27 to 349
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Mature protein without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab203539 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

    Mass Spectrometry

  • Mass spectrometry

    LC-MS/MS
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 4.7
    Constituents: 20% Glycerol, 79% Citrate buffer

General Info

  • Alternative names

    • CCN 2
    • CCN family member 2
    • CCN2
    • Connective tissue growth factor
    • Ctgf
    • CTGF_HUMAN
    • Hcs 24
    • Hcs24
    • Hypertrophic chondrocyte specific protein 24
    • Hypertrophic chondrocyte-specific gene product 24
    • Hypertrophic chondrocyte-specific protein 24
    • IBP-8
    • IGF-binding protein 8
    • IGFBP-8
    • IGFBP8
    • Insulin like Growth Factor Binding Protein 8
    • Insulin-like growth factor-binding protein 8
    • MGC102839
    • NOV 2
    • NOV2
    see all
  • Function

    Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis.
  • Tissue specificity

    Expressed in bone marrow and thymic cells. Also expressed one of two Wilms tumors tested.
  • Sequence similarities

    Belongs to the CCN family.
    Contains 1 CTCK (C-terminal cystine knot-like) domain.
    Contains 1 IGFBP N-terminal domain.
    Contains 1 TSP type-1 domain.
    Contains 1 VWFC domain.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix. Secreted.
  • Information by UniProt

Images

  • 12% SDS-PAGE analysis of ab203539.

    Lane 1: M.W. marker – 14, 21, 31, 45, 66, 97 kDa
    Lane 2: Reduced and heated sample, 2.5μg / lane
    Lane 3: Non-reduced and non-heated sample, 2.5μg / lane

References

ab203539 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203539.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up