Description

  • Product name

    Recombinant Human CTHRC1 protein
    See all CTHRC1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purification method: 6xHis tag / Immobilized-metal affinity chromatography (IMAC).
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGI PGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTK MRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQ GSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGW NSVSRIIIEELPK
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      31 to 243
    • Additional sequence information

      Mature protein. NCBI Accession No. NP_612464.1.

Specifications

Our Abpromise guarantee covers the use of ab187209 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Reconstitute for long term storage.

    pH: 8.00
    Preservative: 1.7% Imidazole
    Constituents: 0.33% Sodium phosphate, 2.9% Sodium chloride, 1.74% DL-Arginine, 0.0078% Beta mercaptoethanol

General Info

  • Alternative names

    • Collagen triple helix repeat containing 1
    • Collagen triple helix repeat containing protein 1
    • Collagen triple helix repeat-containing protein 1
    • CTHR1_HUMAN
    • Cthrc1
    • NMTC1 protein
    • Protein NMTC1
    see all
  • Function

    May act as a negative regulator of collagen matrix deposition.
  • Tissue specificity

    Isoform 1 is expressed in calcified atherosclerotic plaque and chondrocyte-like cells.
  • Sequence similarities

    Contains 1 collagen-like domain.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • Western blot analysis of ab187209.

  • 15% SDS-PAGE analysis of ab187209 stained with Coomasie Blue.

References

ab187209 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187209.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up