Description

  • Product name

    Recombinant Human CTLA4 protein
    See all CTLA4 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCA ATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYP PPYYLGIGNGTQIYVIDPEPCPDSDF
    • Predicted molecular weight

      14 kDa including tags
    • Amino acids

      37 to 162
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167727 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 99% PBS

    Lyophilized from 0.22 µm filtered solution.
    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in 200 µl sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • ALPS5
    • CD
    • CD 152
    • CD152
    • CD152 antigen
    • CD152 isoform
    • Celiac disease 3
    • CELIAC3
    • CTLA 4
    • CTLA-4
    • CTLA4
    • CTLA4_HUMAN
    • Cytotoxic T cell associated 4
    • Cytotoxic T lymphocyte antigen 4
    • Cytotoxic T lymphocyte associated 4
    • Cytotoxic T lymphocyte associated 4, soluble isoform, included
    • Cytotoxic T lymphocyte associated antigen 4
    • Cytotoxic T lymphocyte associated antigen 4 short spliced form
    • Cytotoxic T lymphocyte associated protein 4
    • Cytotoxic T lymphocyte associated serine esterase 4
    • Cytotoxic T lymphocyte protein 4
    • Cytotoxic T-lymphocyte protein 4
    • Cytotoxic T-lymphocyte-associated antigen 4
    • GRD4
    • GSE
    • ICOS
    • IDDM12
    • insulin-dependent diabetes mellitus 12
    • Ligand and transmembrane spliced cytotoxic T lymphocyte associated antigen 4
    • OTTHUMP00000216623
    see all
  • Function

    Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.
  • Tissue specificity

    Widely expressed with highest levels in lymphoid tissues. Detected in activated T-cells where expression levels are 30- to 50-fold less than CD28, the stimulatory coreceptor, on the cell surface following activation.
  • Involvement in disease

    Genetic variation in CTLA4 influences susceptibility to systemic lupus erythematosus (SLE) [MIM:152700]. SLE is a chronic, inflammatory and often febrile multisystemic disorder of connective tissue. It affects principally the skin, joints, kidneys and serosal membranes. SLE is thought to represent a failure of the regulatory mechanisms of the autoimmune system.
    Note=Genetic variations in CTLA4 may influence susceptibility to Graves disease, an autoimmune disorder associated with overactivity of the thyroid gland and hyperthyroidism.
    Genetic variation in CTLA4 is the cause of susceptibility to diabetes mellitus insulin-dependent type 12 (IDDM12) [MIM:601388]. A multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical fetaures are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These derangements result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels.
    Genetic variation in CTLA4 is the cause of susceptibility to celiac disease type 3 (CELIAC3) [MIM:609755]. It is a multifactorial disorder of the small intestine that is influenced by both environmental and genetic factors. It is characterized by malabsorption resulting from inflammatory injury to the mucosa of the small intestine after the ingestion of wheat gluten or related rye and barley proteins. In its classic form, celiac disease is characterized in children by malabsorption and failure to thrive.
  • Sequence similarities

    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    N-glycosylation is important for dimerization.
    Phosphorylation at Tyr-201 prevents binding to the AP-2 adapter complex, blocks endocytosis, and leads to retention of CTLA4 on the cell surface.
  • Cellular localization

    Cell membrane. Exists primarily an intracellular antigen whose surface expression is tightly regulated by restricted trafficking to the cell surface and rapid internalisation and.
  • Information by UniProt

Images

  • SDS-PAGE of reduced ab167727 stained overnight with Coomassie Blue.
  • Immobilized Human B7-1, Fc Tag (ab173993) at 2μg/mL (100 μL/well) can bind ab167727 with a linear range of 0.16-2.56 ng/mL

  • Immobilized Human B7-2, Fc Tag (ab167720) at 2μg/mL (100 μL/well) can bind ab167727 with a linear range of 1-6.4 ng/mL 

  • Yervoy (Ipilimumab, Human IgG1) captured on CM5 chip via anti-human IgG Fc antibodies surface, can bind ab167727 with an affinity constant of 25.7 nM as determined is SPR assay.

References

ab167727 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167727.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up