Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEE NFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQS SGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATGAEEELLPGVD VLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDL PRRLRGPQKDELKSFILQKYMMVDSA
    • Molecular weight
      51 kDa including tags
    • Amino acids
      1 to 226

Specifications

Our Abpromise guarantee covers the use of ab132868 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA18I14.5
    • C10orf66
    • Chromosome 10 open reading frame 66
    • CUE domain containing 2
    • CUE domain-containing protein 2
    • CUED2
    • CUED2_HUMAN
    • Cuedc2
    • MGC2491
    • OTTHUMP00000020368
    see all
  • Function
    Controls PGR and ESR1 protein levels through their targeting for ubiquitination and subsequent proteasomal degradation.
  • Sequence similarities
    Belongs to the CUEDC2 family.
    Contains 1 CUE domain.
  • Domain
    The CUE domain mediates interaction with PGR and ESR1.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132868 stained with Coomassie Blue.

References

ab132868 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132868.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up