Recombinant Human Cullin 4B/CUL-4B protein (ab160035)

Overview

  • Product name
    Recombinant Human Cullin 4B/CUL-4B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MMSQSSGSGDGNDDEATTSKDGGFSSPSPSAAAAAQEVRSATDGNTSTTP PTSAKKRKLNSSSSSSSNSSNEREDFDSTSSSSSTPPLQPRDSASPSTSS FCLGVSVAASSHVPIQKKLRFEDTLEFVGFDAKMAEESSSSSSSSSPTAA TSQQQQLKNKSILISSVASVHHANGLAKSSTTVSSFANSKPGSAKKLVIK NFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSY KISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQM IMIRSIFLFLDRTYVLQNSMLPSIWDMGLELFRAHIISDQKVQNKTIDGI LLLIERERNGEAIDRSLLRSLLSMLSDLQIYQDSFEQRFLEETNRLYAAE GQKLMQEREVPEYLHHVNKRLEEEADRLITYLDQTTQKSLIATVEKQLLG EHLTAILQKGLNNLLDENRIQDLSLLYQLFSRVRGGVQVLLQQWIEYIKA FGSTIVINPEKDKTMVQELLDFKDKVDHIIDICFLKNEKFINAMKEAFET FINKRPNKPAELIAKYVDSKLRAGNKEATDEELEKMLDKIMIIFRFIYGK DVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGAAFTSKLEGMFK DMELSKDIMIQFKQYMQNQNVPGNIELTVNILTMGYWPTYVPMEVHLPPE MVKLQEIFKTFYLGKHSGRKLQWQSTIGHCVLKAEFKEGKKELQVSLFQT LVLLMFNEGEEFSLEEIKQATGIEDGELRRTLQSLACGKARVLAKNPKGK DIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTERVFQDRQYQI DAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYME RDKENPNQYNYIA
    • Amino acids
      1 to 913
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160035 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously labeled as Cullin 4B.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CUL 4B
    • CUL-4B
    • CUL4B
    • CUL4B_HUMAN
    • Cullin-4B
    • DKFZp686F1470
    • KIAA0695
    • MRXHF2
    • MRXSC
    • SFM2
    see all
  • Function
    Core component of multiple cullin-RING-based E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. The functional specificity of the E3 ubiquitin-protein ligase complex depends on the variable substrate recognition subunit. CUL4B may act within the complex as a scaffold protein, contributing to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. Plays a role as part of the E3 ubiquitin-protein ligase complex in polyubiquitination of CDT1, histone H2A, histone H3 and histone H4 in response to radiation-induced DNA damage. Targeted to UV damaged chromatin by DDB2 and may be important for DNA repair and DNA replication. Required for ubiquitination of cyclin E, and consequently, normal G1 cell cycle progression. Regulates the mammalian target-of-rapamycin (mTOR) pathway involved in control of cell growth, size and metabolism. Specific CUL4B regulation of the mTORC1-mediated pathway is dependent upon 26S proteasome function and requires interaction between CUL4B and MLST8.
  • Pathway
    Protein modification; protein ubiquitination.
  • Involvement in disease
    Defects in CUL4B are the cause of mental retardation syndromic X-linked Cabezas type (MRXC) [MIM:300354]; also known as mental retardation syndromic X-linked type 15. A syndromic form of X-linked mental retardation characterized by severe intellectual deficit associated with short stature, craniofacial dysmorphism, small testes, muscle wasting in lower legs, kyphosis, joint hyperextensibility, pes cavus, small feet, and abnormalities of the toes. Additional neurologic manifestations include speech delay and impairment, tremor, seizures, gait ataxia, hyperactivity and decreased attention span.
  • Sequence similarities
    Belongs to the cullin family.
  • Post-translational
    modifications
    Neddylated. Deneddylated via its interaction with the COP9 signalosome (CSN) complex.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160035 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160035 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160035.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up