Description

  • Product name

    Recombinant Human CUTC protein
  • Purity

    > 95 % SDS-PAGE.
    ab111633 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMKRQGASSERKRARIPSGKAGAANGFLMEV CVDSVESAVNAERGGADRIELCSGLSEGGTTPSMGVLQVVKQSVQIPVFV MIRPRGGDFLYSDREIEVMKADIRLAKLYGADGLVFGALTEDGHIDKELC MSLMAICRPLPVTFHRAFDMVHDPMAALETLLTLGFERVLTSGCDSSALE GLPLIKRLIEQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARSTRD SGMKFRNSSVAMGASLSCSEYSLKVTDVTKVRTLNAIAKNILV
    • Predicted molecular weight

      32 kDa including tags
    • Amino acids

      1 to 273
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab111633 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.08% DTT, 1.17% Sodium chloride

General Info

  • Alternative names

    • CGI 32
    • CGI32
    • Copper homeostasis protein cutC homolog
    • cutC
    • CutC copper transporter homolog (E. coli)
    • CUTC_HUMAN
    • RP11-483F11.3
    see all
  • Function

    May play a role in copper homeostasis. Can bind one Cu(1+) per subunit.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the CutC family.
  • Cellular localization

    Cytoplasm. Nucleus. The overexpressed protein is detected in the cytoplasm, and depending on the cell line, also in the nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab111633 at approximately 31.5kDa (3µg).

References

ab111633 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab111633.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up