Recombinant Human CUZD1 protein (ab162346)

Overview

  • Product name
    Recombinant Human CUZD1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YPLFGHYGRFQFNAFKFLRSMSSVYLQCKVLICDSSDHQSRCNQGCVSRS KRDISSYKWKTDSIIGPIRLKRDRSASGNSGFQHETHAEETPNQPFNSVH
    • Amino acids
      471 to 570
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162346 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CUB and zona pellucida-like domain-containing protein 1
    • CUB and ZP domain-containing protein 1
    • CUZD1
    • CUZD1_HUMAN
    • Transmembrane protein UO-44
    see all
  • Function
    CUZD1 antiserum inhibits cell attachment and proliferation of ovarian cancer cells so may be involved in these processes. May also play a role in the uterus during late pregnancy and/or in trypsin activation in pancreatic acinar cells.
  • Tissue specificity
    Detected in pancreas and epithelium of ovary. Expressed at higher levels in ovarian tumors than in normal tissue.
  • Sequence similarities
    Contains 2 CUB domains.
    Contains 1 ZP domain.
  • Cellular localization
    Cytoplasmic vesicle > secretory vesicle membrane. Associated with zymogen granule membranes.
  • Information by UniProt

Images

  • ab162346 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162346 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162346.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up