Recombinant Human Cx30 protein (Tagged) (ab161163)

Overview

  • Product name
    Recombinant Human Cx30 protein (Tagged)
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GDEQEDFVCNTLQPGCKNVCYDHFFPVSHIR
    • Amino acids
      45 to 75
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161163 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously known as GJB6.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Connexin 30
    • Connexin-30
    • Cx30
    • CXB6_HUMAN
    • DFNA3
    • DFNA3B
    • DFNB1B
    • ECTD2
    • ectodermal dysplasia 2, hidrotic (Clouston syndrome)
    • ED2
    • EDH
    • Gap junction beta 6 protein
    • Gap junction beta-6 protein
    • gap junction protein, beta 6
    • gap junction protein, beta 6 (connexin 30)
    • Gap junction protein, beta 6, 30kDa
    • GJB6
    • HED
    • HED2
    • NSRD1
    see all
  • Function
    One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
  • Involvement in disease
    Defects in GJB6 are the cause of ectodermal dysplasia type 2 (ED2) [MIM:129500]; also known as Clouston syndrome. Ectodermal dysplasia defines a heterogeneous group of disorders due to abnormal development of two or more ectodermal structures. ED2 is an autosomal dominant condition characterized by atrichosis, nail hypoplasia and deformities, hyperpigmentation of the skin, normal teeth, normal sweat and sebaceous gland function. Palmoplantar hyperkeratosis is a frequent features. Hearing impairment has been detected in few cases of ED2.
    Defects in GJB6 are the cause of deafness autosomal recessive type 1B (DFNB1B) [MIM:612645]. DFNB1B is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information.
    Defects in GJB6 are the cause of deafness autosomal dominant type 3B (DFNA3B) [MIM:612643].
  • Sequence similarities
    Belongs to the connexin family. Beta-type (group I) subfamily.
  • Cellular localization
    Cell membrane. Cell junction > gap junction.
  • Information by UniProt

Images

  • ab161163 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161163 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161163.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up