Description

  • Product name

    Recombinant Human CX3CL1 protein (His tag)
    See all CX3CL1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFC ADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDES VVLEPEATGESSSLEPTPSS QEAQRALGTSPELPTGVTGSSGTRLPPT PKAQDGGPVGTELFRVPPVSTAATWQSSAPHQPGPSLWAEAKTSEAPSTQ DPSTQASTASSPAPEENAPSEGQRVWGQGQSPRPENSLEREEMGPVPAHT DAFQDWGPGSMAHVSVVPVSSEGTPSREPVASGSWTPKAEEPIHATMDPQ RLGVLITPVPDAQAATRRQ
    • Predicted molecular weight

      36 kDa including tags
    • Amino acids

      25 to 341
    • Tags

      His tag C-Terminus
    • Additional sequence information

      (Accession # AAH01163) .

Specifications

Our Abpromise guarantee covers the use of ab219718 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 95% PBS

    Lyophilized from 0.22 µm filtered solution.
    Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • A 152E5.2
    • AB030188
    • ABCD 3
    • ABCD3
    • AI848747
    • C-X3-C motif chemokine 1
    • C3Xkine
    • Chemokine (C-X3-C motif) ligand 1
    • Chemokine C X3 C motif ligand 1
    • Chemokine CX3C Motif Ligand 1
    • CX3C membrane anchored chemokine
    • CX3C membrane-anchored chemokine
    • Cx3cl1
    • CXC 3
    • CXC3
    • CXC3C
    • D8Bwg0439e
    • FKN
    • Fractalkine
    • Neurotactin
    • NTN
    • NTT
    • Processed fractalkine
    • SCYD 1
    • SCYD1
    • Small inducible cytokine D1
    • Small inducible cytokine subfamily D (Cys X3 Cys) member 1
    • small inducible cytokine subfamily D (Cys-X3-Cys), member 1 (fractalkine, neurotactin)
    • Small inducible cytokine subfamily D member 1
    • Small-inducible cytokine D1
    • X3CL1_HUMAN
    see all
  • Function

    The soluble form is chemotactic for T-cells and monocytes, but not for neutrophils. The membrane-bound form promotes adhesion of those leukocytes to endothelial cells. May play a role in regulating leukocyte adhesion and migration processes at the endothelium. Binds to CX3CR1.
  • Tissue specificity

    Small intestine, colon, testis, prostate, heart, brain, lung, skeletal muscle, kidney and pancreas.
  • Sequence similarities

    Belongs to the intercrine delta family.
  • Post-translational
    modifications

    A soluble short 95 kDa form may be released by proteolytic cleavage from the long membrane-anchored form.
    O-glycosylated with core 1 or possibly core 8 glycans.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab219718 stained overnight with Coomassie Blue.

References

ab219718 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219718.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up