Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNL LVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNA MCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTIS LGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGF LLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVFFLFWTPYNVM IFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKF RRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGD ALLLL
    • Molecular weight
      65 kDa
    • Amino acids
      1 to 355
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112276 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

    Other

  • Form
    Liquid
  • Additional notes
    Best to use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Constituents: 0.31% Glutathione, 0.79% Tris HCl

    Reduced Glutathione

General Info

  • Alternative names
    • Beta chemokine receptor-like 1
    • C X3 C CKR 1
    • C-X3-C CKR-1
    • CCRL1
    • Chemokine C X3 C motif receptor 1
    • CMK BRL 1
    • CMK-BRL-1
    • CMK-BRL1
    • CMKBLR1
    • CMKDR1
    • CX3C chemokine receptor 1
    • CX3C CKR1
    • CX3C1_HUMAN
    • CX3CR1
    • Fractalkine receptor
    • G-protein coupled receptor 13
    • GPR13
    • GPRV28
    • V28
    see all
  • Function
    Receptor for the CX3C chemokine fractalkine and mediates both its adhesive and migratory functions. Acts as coreceptor with CD4 for HIV-1 virus envelope protein (in vitro). Isoform 2 and isoform 3 seem to be more potent HIV-1 coreceptors than isoform 1.
  • Tissue specificity
    Expressed in lymphoid and neural tissues.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • Anti-CX3CR1 antibody (ab8021) at 1 µg/ml + Recombinant Human CX3CR1 protein (ab112276) at 0.01 µg

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) preadsorbed (ab97080) at 1/5000 dilution

    Developed using the ECL technique.

    Performed under reducing conditions.

    Predicted band size: 65.12 kDa


    Exposure time: 4 minutes
  • 12.5% SDS-PAGE analysis of ab112276, stained with Coomassie Blue.

References

ab112276 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112276.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up