Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHC LHPKLQSTKRFIKWYNAWNEKRRVYE E
    • Molecular weight

      9 kDa
    • Amino acids

      35 to 111

Specifications

Our Abpromise guarantee covers the use of ab138785 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The ED50 as determined by its ability to induce calcium flux of prostaglandin E2 treated THP1 human acute monocytic leukemia cells was 1.0-10.0 ng/ml.
  • Applications

    HPLC

    SDS-PAGE

    Functional Studies

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Purity is > 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Additional notes

    Lyophilized ab138785 should be stored at less than -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4°C for 2-7 days. Aliquots of reconstituted samples are stable at less than -20°C for 3 months. Avoid repeated freeze thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 8.50
    Constituents: 0.32% Tris HCl, 5.8% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute ab138785 in sterile 18Ohm-cm H2O not less than 100 µg/ml. This can further be diluted to other aqueous buffers.

General Info

  • Alternative names

    • 1110031L23Rik
    • 1200006I23Rik
    • AI414372
    • BMAC
    • bolekine
    • BRAK
    • Breast and kidney
    • C-X-C motif chemokine 14
    • C-X-C motif chemokine ligand 14
    • Chaemokine, CXC motif, ligand 14
    • Chemokine (C-X-C motif) ligand 14
    • Chemokine BRAK
    • CXC chemokine in breast and kidney
    • CXCL14
    • CXL14_HUMAN
    • JSC
    • Kec
    • Kidney-expressed chemokine CXC
    • KS1
    • MGC10687
    • MGC124510
    • MGC90667
    • MIP 2 gamma
    • MIP-2G
    • MIP2G
    • MIP2gamma
    • NJAC
    • PRO273
    • PSEC0212
    • Scyb14
    • Small Inducible Cytokine B14
    • Small inducible cytokine subfamily B (Cys-X-Cys) member 14 (BRAK)
    • Small Inducible Cytokine subfamily B, member 14
    • Small-inducible cytokine B14
    • Tumor suppressing chemokine
    • UNQ240
    see all
  • Function

    Potent chemoattractant for neutrophils, and weaker for dendritic cells. Not chemotactive for T-cells, B-cells, monocytes, natural killer cells or granulocytes. Does not inhibit proliferation of myeloid progenitors in colony formation assays.
  • Tissue specificity

    Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Highly expressed in normal tissue without inflammatory stimuli and infrequently expressed in cancer cell lines. Weakly expressed in monocyte-derived dendritic cells. Not detected in lung or unstimulated peripheral blood lymphocytes.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab138785 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab138785.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up