Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEI CLDPEAPFLKKVIQKILDGGNKEN
    • Molecular weight

      8 kDa
    • Amino acids

      41 to 114
    • Additional sequence information

      Non-glycosylated protein.

Specifications

Our Abpromise guarantee covers the use of ab207960 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The activity can be determined by its ability to induce chemotaxis of primary Human neutrophils starting at a concentration of 10 ng/mL. This corresponds to an expected specific activity of 1 x 105 units/mg.

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level

    < 0.050 Eu/µg
  • Purity

    = 95 % SDS-PAGE.
    Purity is typically 95% as determined by reducing and non-reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    Constituent: 0.1% Trifluoroacetic acid

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with sterile water to 0.1 mg/mL. Centrifuge vial before opening. Suspend the product by gently pipetting down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. Dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

General Info

  • Alternative names

    • AMCFII
    • C-X-C motif chemokine 5
    • C-X-C motif chemokine ligand 5
    • Chemokine (C X C motif) ligand 5
    • chemokine (C-X-C motif) ligand 5
    • Cxcl5
    • CXCL5_HUMAN
    • ENA 78
    • ENA-78 (8-78)
    • ENA-78(1-78)
    • ENA-78(9-78)
    • ENA78
    • Epithelial derived neutrophil activating protein 78
    • Epithelial-derived neutrophil-activating protein 78
    • Lipopolysaccharide-induced CXC chemokine
    • Neutrophil activating peptide ENA 78
    • Neutrophil activating protein 78
    • Neutrophil-activating peptide ENA-78
    • neutrophil-activating protein 78
    • SCYB5
    • Small inducible cytokine B5
    • small inducible cytokine subfamily B (Cys-X-Cys), member 5 (epithelial-derived neutrophil-activating peptide 78)
    • small inducible cytokine subfamily B, member 5
    • Small-inducible cytokine B5
    see all
  • Function

    Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Post-translational
    modifications

    N-terminal processed forms ENA-78(8-78) and ENA-78(9-78) are produced by proteolytic cleavage after secretion from peripheral blood monocytes.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab207960 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207960.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up