Description

  • Product name

    Recombinant human CXCL5 protein (Active)
    See all CXCL5 proteins and peptides
  • Biological activity

    The activity can be determined by its ability to induce chemotaxis of primary Human neutrophils starting at a concentration of 10 ng/mL.  There is no data currently available for this product. This corresponds to an expected specific activity of 1 x 105 units/mg.

  • Purity

    > 95 % SDS-PAGE.
    Purity of ab218084 is typically 95% as determined by reducing and non-reducing SDS-PAGE.
  • Endotoxin level

    < 0.050 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEI CLDPEAPFLKKVIQKILDGGNKEN
    • Predicted molecular weight

      8 kDa
    • Amino acids

      41 to 114
    • Additional sequence information

      Produced in E. coli. There are a number of variants of this mature protein without the signal peptide. This version of the mature protein is amino acids 5-78.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab218084 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. The product can be stored for up to 12 months.

    Constituent: 0.1% Trifluoroacetic acid

    Lyophilized from a sterile filtered aqueous solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in sterile water at 0.1 mg/mL. Centrifuge vial before opening. Suspend the product by gently pipetting sterile water down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. Store at 4ºC. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 ºC and avoid repeat freeze thaws.

General Info

  • Alternative names

    • AMCFII
    • C-X-C motif chemokine 5
    • C-X-C motif chemokine ligand 5
    • Chemokine (C X C motif) ligand 5
    • chemokine (C-X-C motif) ligand 5
    • Cxcl5
    • CXCL5_HUMAN
    • ENA 78
    • ENA-78 (8-78)
    • ENA-78(1-78)
    • ENA-78(9-78)
    • ENA78
    • Epithelial derived neutrophil activating protein 78
    • Epithelial-derived neutrophil-activating protein 78
    • Lipopolysaccharide-induced CXC chemokine
    • Neutrophil activating peptide ENA 78
    • Neutrophil activating protein 78
    • Neutrophil-activating peptide ENA-78
    • neutrophil-activating protein 78
    • SCYB5
    • Small inducible cytokine B5
    • small inducible cytokine subfamily B (Cys-X-Cys), member 5 (epithelial-derived neutrophil-activating peptide 78)
    • small inducible cytokine subfamily B, member 5
    • Small-inducible cytokine B5
    see all
  • Function

    Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Post-translational
    modifications

    N-terminal processed forms ENA-78(8-78) and ENA-78(9-78) are produced by proteolytic cleavage after secretion from peripheral blood monocytes.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • Functional analysis of ab218084

References

ab218084 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218084.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up