Description

  • Product name

    Recombinant Human CXCL7/PBP protein
    See all CXCL7/PBP proteins and peptides
  • Purity

    >= 95 % SDS-PAGE.

  • Endotoxin level

    <=1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDP DAPRIKKIVQKKLAGDESAD
    • Predicted molecular weight

      8 kDa including tags
    • Amino acids

      59 to 128

Associated products

Specifications

Our Abpromise guarantee covers the use of ab233672 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Previously labelled as CXCL7. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    pH: 7.50
    Constituent: 0.16% Sodium phosphate

    Lyophilized from a sterile (0.2 micron) filtered aqueous solution.

  • Reconstitution
    Reconsitute with sterile water at 0.1 mg/ml. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C, and avoid repeat freeze thaws.

General Info

  • Alternative names

    • B TG1
    • Beta TG
    • Beta thromboglobulin
    • Beta-TG
    • C-X-C motif chemokine 7
    • Chemokine (C X C motif) ligand 7
    • Connective tissue activating peptide III
    • CTAP 3
    • CTAP III
    • CTAP-III
    • CTAP-III(1-81)
    • CTAP3
    • CTAPIII
    • CXC chemokine ligand 7
    • CXCL 7
    • CXCL7
    • CXCL7_HUMAN
    • LA PF 4
    • LA-PF4
    • LDGF
    • Leukocyte derived growth factor
    • Leukocyte-derived growth factor
    • Low-affinity platelet factor IV
    • Macrophage-derived growth factor
    • MDGF
    • NAP 2
    • NAP-2
    • NAP-2(1-63)
    • NAP-2(1-66)
    • NAP-2(73)
    • NAP-2(74)
    • Neutrophil activating peptide 2
    • Neutrophil-activating peptide 2(1-63)
    • PBP
    • Platelet basic protein
    • PPBP
    • Pro platelet basic protein
    • Pro platelet basic protein (chemokine (C-X-C motif) ligand 7)
    • SCYB7
    • Small inducible cytokine subfamily B member 7
    • Small-inducible cytokine B7
    • TC1
    • TC2
    • TGB
    • TGB1
    • THBGB
    • THBGB1
    • Thrombocidin 1
    • Thrombocidin 2
    • Thromboglobulin, beta-1
    see all
  • Function

    LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III(1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation.
  • Sequence similarities

    Belongs to the intercrine alpha (chemokine CxC) family.
  • Post-translational
    modifications

    Proteolytic removal of residues 1-9 produces the active peptide connective tissue-activating peptide III (CTAP-III) (low-affinity platelet factor IV (LA-PF4)).
    Proteolytic removal of residues 1-13 produces the active peptide beta-thromboglobulin, which is released from platelets along with platelet factor 4 and platelet-derived growth factor.
    NAP-2(1-66) is produced by proteolytical processing, probably after secretion by leukocytes other than neutrophils.
    NAP-2(73) and NAP-2(74) seem not be produced by proteolytical processing of secreted precursors but are released in an active form from platelets.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 1 µg ab233672 analyzed on a 4-20% Tris-Glycine gel, stained with Coomassie Blue.

    Lane 1: Non-reducing conditions.

    Lane 2: Reducing conditions.

References

ab233672 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233672.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up