Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLN FDR
    • Molecular weight
      31 kDa including tags
    • Amino acids
      1 to 53
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112296 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    useful for Antibody Production and Protein Array
  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • C-X-C chemokine receptor type 3
    • CD 183
    • CD182
    • CD183
    • Chemokine (C X C motif) receptor 3
    • Chemokine (C X C) receptor 3
    • Chemokine CXC Motif Receptor 3
    • CKR L2
    • CKR-L2
    • CKRL2
    • CMKAR3
    • CXC-R3
    • CXCR-3
    • CXCR3
    • CXCR3_HUMAN
    • G Protein Coupled Receptor 9
    • G protein-coupled receptor 9
    • GPR9
    • Interferon-inducible protein 10 receptor
    • IP-10 receptor
    • IP10
    • IP10 R
    • IP10 receptor
    • IP10-R
    • IP10R
    • Mig R
    • Mig receptor
    • Mig-R
    • MIGR
    see all
  • Function
    Receptor for CXCL9, CXCL10 and CXCL11 and mediates the proliferation of human mesangial cells (HMC).
    Isoform 2 is a receptor for CXCL4 and also mediates the inhibitory activities of CXCL9, CXCL10 and CXCL11 on the growth of human microvascular endothelial cells (HMVEC). May play a role in angiogenesis.
    Isoform 3 mediates the activity of CXCL11.
  • Tissue specificity
    Isoform 1 and isoform 2 are mainly expressed in heart, kidney, liver and skeletal muscle. Isoform 1 is also expressed in placenta.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab112296 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab112296 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Answer

Thank youand your customer for confirming these details and for your cooperation.

I am sorry this product did not perform as stated on the datasheet and for the inconvenience this has caused. As requested, I have issued a free of charge replacement.

Unfortunately this free of charge replacement is not in stock at the moment but will be included in your next shipment as soon as it is in stock (approximately 1-2 weeks).

Please note that this free of charge replacement vial is also covered by our Abpromise guarantee. Should you still be experiencing difficulties, or if you have any further questions, please do not hesitate to let us know.


Inoticed the we do have another ab112296 on order 1096009(PO-14295) for the full price. Could you confirm that you would like one as free of charge replacement and the second one for the full price?


I wish your customerthe best of luck withtheir research.

Read More

Answer

Thank you and your customerfor taking the time to contact us. I am sorry to hear your customerhas had difficulty obtaining satisfactory results from this product.

The details your customerhas kindly provided will provide us with vital information for our monitoring of product quality.

I appreciate the time your customerhas spent in the laboratory and understandtheir concerns. It is regrettable the results have not been successful. Reviewing the details, I am sorry there are no further tips to provide on this occasion to help improve the results. I can suggest your customerhas regrettably received a bad vial.

I contacted the source of this protein in order to find the problem.

I apologize for the inconvenience and am pleased to offer your customera free of charge replacement with an alternative product or credit note in compensation.

Thank you and your customerfor your cooperation. I look forward to hearing from you with details of how your customerwould like to proceed.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up