For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-cxcr4-protein-ab155716.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Innate Immunity Chemokines Alpha Chemokine Rec. (CXCR)
Share by email

Recombinant Human CXCR4 protein (ab155716)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human CXCR4 protein (ab155716)

    Key features and details

    • Expression system: HEK 293 cells
    • Purity: > 95% SDS-PAGE
    • Endotoxin level: < 0.100 Eu/µg
    • Suitable for: SDS-PAGE

    You may also be interested in

    Primary
    Product image
    Anti-CXCR4 antibody [UMB2] - BSA and Azide free (ab197203)
    Primary
    Product image
    Alexa Fluor® 488 Anti-CXCR4 antibody [UMB2] (ab208128)
    Primary
    Product image
    Anti-CXCR4 antibody (ab227767)

    View more associated products

    Description

    • Product name

      Recombinant Human CXCR4 protein
      See all CXCR4 proteins and peptides
    • Purity

      > 95 % SDS-PAGE.

    • Endotoxin level

      < 0.100 Eu/µg
    • Expression system

      HEK 293 cells
    • Accession

      P61073
    • Protein length

      Protein fragment
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS
      • Predicted molecular weight

        33 kDa
      • Amino acids

        1 to 46

    Associated products

      Specifications

      Our Abpromise guarantee covers the use of ab155716 in the following tested applications.

      The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

      • Applications

        SDS-PAGE

      • Form

        Lyophilized
      • Additional notes

        In DTT-reduced SDS-PAGE, ab155716 migrates as 40-50 kDa poly peptide due to glycosylation.
      • Concentration information loading...

      Preparation and Storage

      • Stability and Storage

        Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

        pH: 7.4
        Constituents: 5% Trehalose, 0.75% Glycine, 0.61% Tris

      • Reconstitution
        Reconstitute with sterile deionized water to a concentration of 400 µg/ml.

      General Info

      • Alternative names

        • C-X-C chemokine receptor type 4
        • CD184
        • CD184 antigen
        • Chemokine (C X C motif) receptor 4
        • Chemokine CXC Motif Receptor 4
        • CXC-R4
        • CXCR-4
        • CXCR4
        • CXCR4_HUMAN
        • D2S201E
        • FB22
        • Fusin
        • HM89
        • HSY3RR
        • LAP 3
        • LAP3
        • LCR1
        • LESTR
        • Leukocyte derived seven transmembrane domain receptor
        • Leukocyte-derived seven transmembrane domain receptor
        • Lipopolysaccharide associated protein 3
        • Neuropeptide Y receptor Y3
        • NPY3R
        • NPYR
        • NPYRL
        • NPYY3
        • NPYY3R
        • Probable G protein coupled receptor lcr1 homolog
        • SDF 1 receptor
        • SDF-1 receptor
        • SEVEN-TRANSMEMBRANE-SEGMENT RECEPTOR
        • Stromal cell derived factor 1 receptor
        • Stromal cell-derived factor 1 receptor
        • WHIM
        • WHIMS
        see all
      • Function

        Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ions levels and enhancing MAPK1/MAPK3 activation. Acts as a receptor for extracellular ubiquitin; leading to enhance intracellular calcium ions and reduce cellular cAMP levels. Involved in haematopoiesis and in cardiac ventricular septum formation. Plays also an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Could be involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival. Acts as a coreceptor (CD4 being the primary receptor) for HIV-1 X4 isolates and as a primary receptor for some HIV-2 isolates. Promotes Env-mediated fusion of the virus.
      • Tissue specificity

        Expressed in numerous tissues, such as peripheral blood leukocytes, spleen, thymus, spinal cord, heart, placenta, lung, liver, skeletal muscle, kidney, pancreas, cerebellum, cerebral cortex and medulla (in microglia as well as in astrocytes), brain microvascular, coronary artery and umbilical cord endothelial cells. Isoform 1 is predominant in all tissues tested.
      • Involvement in disease

        Defects in CXCR4 are a cause of WHIM syndrome (WHIM) [MIM:193670]; also known as warts, hypogammaglobulinemia, infections and myelokathexis. WHIM syndrome is an immunodeficiency disease characterized by neutropenia, hypogammaglobulinemia and extensive human papillomavirus (HPV) infection. Despite the peripheral neutropenia, bone marrow aspirates from affected individuals contain abundant mature myeloid cells, a condition termed myelokathexis.
      • Sequence similarities

        Belongs to the G-protein coupled receptor 1 family.
      • Domain

        The amino-terminus is critical for ligand binding. Residues in all four extracellular regions contribute to HIV-1 coreceptor activity.
      • Post-translational
        modifications

        Phosphorylated on agonist stimulation. Rapidly phosphorylated on serine and threonine residues in the C-terminal. Phosphorylation at Ser-324 and Ser-325 leads to recruitment of ITCH, ubiquitination and protein degradation.
        Ubiquitinated by ITCH at the cell membrane on agonist stimulation. The ubiquitin-dependent mechanism, endosomal sorting complex required for transport (ESCRT), then targets CXCR4 for lysosomal degradation. This process is dependent also on prior Ser-/Thr-phosphorylation in the C-terminal of CXCR4. Also binding of ARRB1 to STAM negatively regulates CXCR4 sorting to lysosomes though modulating ubiquitination of SFR5S.
        Sulfation on Tyr-21 is required for efficient binding of CXCL12/SDF-1alpha and promotes its dimerization.
        O- and N-glycosylated. Asn-11 is the principal site of N-glycosylation. There appears to be very little or no glycosylation on Asn-176. N-glycosylation masks coreceptor function in both X4 and R5 laboratory-adapted and primary HIV-1 strains through inhibiting interaction with their Env glycoproteins. The O-glycosylation chondroitin sulfate attachment does not affect interaction with CXCL12/SDF-1alpha nor its coreceptor activity.
      • Cellular localization

        Cell membrane. In unstimulated cells, diffuse pattern on plasma membrane. On agonist stimulation, colocalizes with ITCH at the plasma membrane where it becomes ubiquitinated.
      • Target information above from: UniProt accession P61073 The UniProt Consortium
        The Universal Protein Resource (UniProt) in 2010
        Nucleic Acids Res. 38:D142-D148 (2010) .

        Information by UniProt

      Images

      • SDS-PAGE - Recombinant Human CXCR4 protein (ab155716)
        SDS-PAGE - Recombinant Human CXCR4 protein (ab155716)
        SDS-PAGE of reduced ab155716 stained overnight with Coomassie Blue.

      Protocols

      To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

      Click here to view the general protocols

      Datasheets and documents

      • SDS download

      • Datasheet download

        Download

      References (0)

      Publishing research using ab155716? Please let us know so that we can cite the reference in this datasheet.

      ab155716 has not yet been referenced specifically in any publications.

      Customer reviews and Q&As

      Show All Reviews Q&A
      Submit a review Submit a question

      There are currently no Customer reviews or Questions for ab155716.
      Please use the links above to contact us or submit feedback about this product.

      Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
      For licensing inquiries, please contact partnerships@abcam.com

      Get resources and offers direct to your inbox Sign up
      A-Z by research area
      • Cancer
      • Cardiovascular
      • Cell biology
      • Developmental biology
      • Epigenetics & Nuclear signaling
      • Immunology
      • Metabolism
      • Microbiology
      • Neuroscience
      • Signal transduction
      • Stem cells
      A-Z by product type
      • Primary antibodies
      • Secondary antibodies
      • Biochemicals
      • Isotype controls
      • Flow cytometry multi-color selector
      • Kits
      • Loading controls
      • Lysates
      • Peptides
      • Proteins
      • Slides
      • Tags and cell markers
      • Tools & Reagents
      Help & support
      • Support
      • Make an Inquiry
      • Protocols & troubleshooting
      • Placing an order
      • RabMAb products
      • Biochemical product FAQs
      • Training
      • Browse by Target
      Company
      • Corporate site
      • Investor relations
      • Company news
      • Careers
      • About us
      • Blog
      Events
      • Tradeshows
      • Conferences
      International websites
      • abcam.cn
      • abcam.co.jp

      Join with us

      • LinkedIn
      • facebook
      • Twitter
      • YouTube
      • Terms of sale
      • Website terms of use
      • Cookie policy
      • Privacy policy
      • Legal
      • Modern slavery statement
      © 1998-2021 Abcam plc. All rights reserved.