Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MMGGESADKATAAAAAASLLANGHDLAAAMAVDKSNPTSKHKSGAVASLL SKAERATELAAEGQLTLQQFAQSTEMLKRVVQEHLPLMSEAGAGLPDMEA VAGAEALNGQSDFPYLGAFPINPGLFIMTPAGVFLAESALHMAGLAEYPM QGELASAISSGKKKRKRCGMCAPCRRRINCEQCSSCRNRKTGHQICKFRK CEELKKKPSAALEKVMLPTGAAFRWFQ
    • Amino acids

      1 to 227
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153354 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CF5
    • CXXC finger 5 protein
    • CXXC finger protein 5
    • CXXC-type zinc finger protein 5
    • CXXC5
    • CXXC5_HUMAN
    • HSPC195
    • Putative MAPK-activating protein PM08
    • Putative NF-kappa-B-activating protein 102
    • retinoid-inducible nuclear factor
    • RINF
    • TCCCIA00297
    • WID
    • WT1-induced Inhibitor of Dishevelled
    see all
  • Function

    May indirectly participate in activation of the NF-kappa-B and MAPK pathways. Acts as a mediator of BMP4-mediated modulation of canonical Wnt signaling activity in neural stem cells.
  • Sequence similarities

    Contains 1 CXXC-type zinc finger.
  • Cellular localization

    Nucleus. Cytoplasm. Colocalizes with DVL1 in large bodies localized just outside the nuclear membrane.
  • Information by UniProt

Images

  • ab153354 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153354 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153354.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up