Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QCFLLFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGF VTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQKMRFTY
    • Amino acids
      207 to 305
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162645 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • b5R.1
    • B5R1
    • B5R2
    • CYB5R1
    • Cytochrome b5 reductase 1
    • EC 1.6.2.2
    • Humb5R2
    • NAD
    • NAD(P)H:quinone oxidoreductase type 3 polypeptide A2
    • NAD(P)H:quinone oxidoreductase type 3, polypeptide A2
    • NADH cytochrome b5 reductase 1
    • NADH-cytochrome b5 reductase 1
    • NB5R1_HUMAN
    • NQO3A2
    • UNQ3049/PRO9865
    see all
  • Function
    NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the flavoprotein pyridine nucleotide cytochrome reductase family.
    Contains 1 FAD-binding FR-type domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab162645 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162645 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162645.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up