Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEETAKID RTARDQCGSQPWDNNAVCADPCSLIPTPDKEDDDRVYPNSTCKPRIIAPS RGSPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLD WLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAA KLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWL NVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILA ASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFR GVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSG KKQSSGPEMA
    • Molecular weight

      71 kDa including tags
    • Amino acids

      1 to 410

Specifications

Our Abpromise guarantee covers the use of ab132935 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CCNE
    • Ccne1
    • CCNE1_HUMAN
    • cyclin E variant ex5del
    • cyclin E variant ex7del
    • Cyclin E1
    • Cyclin Es
    • Cyclin Et
    • CyclinE
    • G1/S specific cyclin E
    • G1/S-specific cyclin-E1
    see all
  • Function

    Essential for the control of the cell cycle at the G1/S (start) transition.
  • Tissue specificity

    Highly expressed in testis and placenta. Low levels in bronchial epithelial cells.
  • Sequence similarities

    Belongs to the cyclin family. Cyclin E subfamily.
  • Post-translational
    modifications

    Phosphorylation of Thr-395 by GSK3 and of Ser-399 by CDK2 accelerates degradation via the ubiquitin proteasome pathway. Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132935 stained with Coomassie Blue

References

ab132935 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132935.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up