Description

  • Product name

    Recombinant Human Cyclin G protein
  • Purity

    > 85 % SDS-PAGE.
    ab116149 was purified using conventional chromatography.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMIEVLTTTDSQKLLHQLNALLEQESRCQPK VCGLRLIESAHDNGLRMTARLRDFEVKDLLSLTQFFGFDTETFSLAVNLL DRFLSKMKVQPKHLGCVGLSCFYLAVKSIEEERNVPLATDLIRISQYRFT VSDLMRMEKIVLEKVCWKVKATTAFQFLQLYYSLLQENLPLERRNSINFE RLEAQLKACHCRIIFSKAKPSVLALSIIALEIQAQKCVELTEGIECLQKH SKINGRDLTFWQELVSKCLTEYSSNKCSKPNVQKLKWIVSGRTARQLKHS YYRITHLPTIPEMVP
    • Predicted molecular weight

      36 kDa including tags
    • Amino acids

      1 to 295
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116149 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 1.17% Sodium chloride, 0.08% DTT, 50% Glycerol, 0.32% Tris HCl

General Info

  • Alternative names

    • CCNG
    • CCNG 1
    • CCNG1
    • CCNG1_HUMAN
    • CYCG1
    • Cyclin G
    • Cyclin G1
    • Cyclin-G
    • Cyclin-G1
    see all
  • Function

    May play a role in growth regulation. Is associated with G2/M phase arrest in response to DNA damage. May be an intermediate by which p53 mediates its role as an inhibitor of cellular proliferation.
  • Tissue specificity

    High levels in skeletal muscle, ovary, kidney and colon.
  • Sequence similarities

    Belongs to the cyclin family. Cyclin G subfamily.
  • Developmental stage

    Very low levels in normal cells during G1 phase, which increase as cells enter the S phase and stay high throughout the S and G2/M phases. In breast cancer cells consistent high levels are found throughout the cell cycle.
  • Cellular localization

    Nucleus. DNA replication foci after DNA damage.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab116149 3ug.

References

ab116149 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116149.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up