Description

  • Product name

    Recombinant Human Cyclin T1 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SNLTSVEMLPGKRWLSSQPSFKLEPTQGHRTSENLALTGVDHSLPQDGSN AFISQKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENMEANVKSQYAY
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      321 to 420

Specifications

Our Abpromise guarantee covers the use of ab152261 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CCN T1
    • CCNT
    • CCNT 1
    • Ccnt1
    • CCNT1_HUMAN
    • CDK9 associated C type protein
    • Cyc T1
    • Cyclin C related protein
    • Cyclin T
    • cyclin T1
    • Cyclin T1b
    • Cyclin-T
    • Cyclin-T1
    • CYCT 1
    • CycT1
    • HIVE1
    • Human immunodeficiency virus 1 expression
    • Human immunodeficiency virus type 1 (HIV 1) expression (elevated) 1
    • pTEFb subunit
    • Subunit of positive elongation transcription factor b
    see all
  • Function

    Regulatory subunit of the cyclin-dependent kinase pair (CDK9/cyclin-T1) complex, also called positive transcription elongation factor B (P-TEFb), which is proposed to facilitate the transition from abortive to productive elongation by phosphorylating the CTD (carboxy-terminal domain) of the large subunit of RNA polymerase II (RNA Pol II). In case of HIV or SIV infections, binds to the transactivation domain of the viral nuclear transcriptional activator, Tat, thereby increasing Tat's affinity for the transactivating response RNA element (TAR RNA). Serves as an essential cofactor for Tat, by promoting RNA Pol II activation, allowing transcription of viral genes.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the cyclin family. Cyclin C subfamily.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152261 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152261.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up