Recombinant Human Cyclin Y protein (ab165923)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGNTTSCCVSSSPKLRRNAHSRLESYRPDTDLSREDTGCNLQHISDRENI DDLNMEFNPSDHPRASTIFLSKSQTDVREKRKSLFINHHPPGQIARKYSS CSTIFLDDSTVSQPNLKYTIKCVALAIYYHIKNRDPDGRMLLDIFDENLH PLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVYLERLL TYAEIDICPANWKRIVLGAILLASKVWDDQAVWNVDYCQILKDITVEDMN ELERQFLELLQFNINVPSSVYAKYYFDLRSLAEANNLSFPLEPLSRERAH KLEAISRLCEDKYKDLRRSARKRSASADNLTLPRWSPAIIS
    • Amino acids
      1 to 341
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165923 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C10orf9
    • CBCP1
    • CCNX
    • CCNY
    • CFP1
    • Chromosome 10 open reading frame 9
    • Cyclin box carrying protein 1
    • Cyclin box protein 1
    • Cyclin fold protein 1
    • Cyclin X
    • Cyclin Y
    see all
  • Relevance
    Cyclin Y is a cyclin which plays a role in the control of cell division cycles and regulation of cyclin dependent kinases (e.g., CDC2; MIM 116940). Single nucleotide polymorphism in Cyclin Y gene is associated with Crohn's disease and ulcerative colitis.
  • Cellular localization
    Cell membrane; Lipid-anchor; Cytoplasmic side. Isoform 3: Nucleus

Images

  • ab165923 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165923 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165923.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up