Recombinant Human Cyclin Y protein (Tagged) (ab174060)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GNTTSCCVSSSPKLRRNAHSRLESYRPDTDLSREDTGCNLQHISDRENID DLNMEFNPSDHPRASTIFLSKSQTDVREKRKSLFINHHPPGQIARKYSSC STIFLDDSTVSQPNLKYTIKCVALAIYYHIKNRDPDGRMLLDIFDENLHP LSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVYLERLLT YAEIDICPANWKRIVLGAILLASKVWDDQAVWNVDYCQILKDITVEDMNE LERQFLELLQFNINVPSSVYAKYYFDLRSLAEANNLSFPLEPLSRERAHK LEAISRLCEDKYKDLRRSARKRSASADNLTLPRWSPAIIS
    • Molecular weight
      65 kDa including tags
    • Amino acids
      2 to 341
    • Tags
      proprietary tag N-Terminus
    • Additional sequence information
      (NM_145012)

Specifications

Our Abpromise guarantee covers the use of ab174060 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Purity
    > 80 % Densitometry.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • C10orf9
    • CBCP1
    • CCNX
    • CCNY
    • CFP1
    • Chromosome 10 open reading frame 9
    • Cyclin box carrying protein 1
    • Cyclin box protein 1
    • Cyclin fold protein 1
    • Cyclin X
    • Cyclin Y
    see all
  • Relevance
    Cyclin Y is a cyclin which plays a role in the control of cell division cycles and regulation of cyclin dependent kinases (e.g., CDC2; MIM 116940). Single nucleotide polymorphism in Cyclin Y gene is associated with Crohn's disease and ulcerative colitis.
  • Cellular localization
    Cell membrane; Lipid-anchor; Cytoplasmic side. Isoform 3: Nucleus

Images

  • SDS-PAGE showing ab174060

References

ab174060 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174060.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up