Description

  • Product name

    Recombinant Human Cyclophilin 40 protein
    See all Cyclophilin 40 proteins and peptides
  • Purity

    > 73 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSSHPSPQAKPSNPSNPRVFF DVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKG CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM ANAGRNTNGSQFFITTVPTPHLDGKHVVFGQVIKGIGVARILENVEVKGE KPAKLCVIAECGELKEGDDGGIFPKDGSGDSHPDFPEDADIDLKDVDKIL LITEDLKNIGNTFFKSQNWEMAIKKYAEVLRYVDSSKAVIETADRAKLQP IALSCVLNIGACKLKMSNWQGAIDSCLEALELDPSNTKALYRRAQGWQGL KEYDQALADLKKAQGIAPEDKAIQAELLKVKQKIKAQKDKEKAVYAKMFA
    • Predicted molecular weight

      68 kDa including tags
    • Amino acids

      2 to 370
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_005038.

Specifications

Our Abpromise guarantee covers the use of ab198461 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.49% Glutathione, 20% Glycerol

General Info

  • Alternative names

    • 40 kDa peptidyl prolyl cis trans isomerase
    • 40 kDa peptidyl prolyl cis trans isomerase D
    • 40 kDa peptidyl-prolyl cis-trans isomerase
    • Cyclophilin D
    • Cyclophilin related protein
    • Cyclophilin-40
    • Cyclophilin-related protein
    • Cyclophilin40
    • CyclophilinD
    • CYP 40
    • CYP-40
    • CYP40
    • CYPD
    • MGC33096
    • Peptidyl Prolyl Isomerase D
    • Peptidyl-prolyl cis-trans isomerase D
    • Peptidylprolyl isomerase D
    • PPIase
    • PPIase D
    • Ppid
    • PPID_HUMAN
    • Rotamase
    • Rotamase D
    see all
  • Function

    PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the cyclophilin-type PPIase family. PPIase D subfamily.
    Contains 1 PPIase cyclophilin-type domain.
    Contains 3 TPR repeats.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of ab198461 with Coomassie staining.

    Lane 1: 3.7 µg ab198461
    Lane 2: Protein marker

References

ab198461 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198461.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up