Description

  • Product name

    Recombinant human Cyclophilin 40 protein
    See all Cyclophilin 40 proteins and peptides
  • Biological activity

    Specific activity is > 210 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1 µmole of suc-AAFP-pNA per minute at 25°C in Tris-Hcl pH8.0 using chymotrypsin.

    Activity Assay

    1. Prepare 170 µl assay buffer into a suitable container and pre-chill on ice before use: The final concentrations are 200 mM Tris-Hcl, pH 8.0, and 20nM chymotrypsin.
    2. Add 10 µl of recombinant Cyclophilin D protein with 1 µg in assay buffer.
    3. Mix by inversion and equilibrate to 1°C and monitor the A405nm until the value is constant using a spectrophotometer.
    4. Add 20 µl pre-chilled 5mM suc-AAFP-pNA. (Substrate was dissolved in TFE that contained 460mM LiCl to a concentration of 3 mM)
    5. Record the increase in A405 nm for 30 minutes at 25°C.
  • Purity

    > 95 % SDS-PAGE.
    ab78815 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSHPSPQAKPSNPSNPRVFFDVDIGGERVG RIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKGCPFHRIIKKF MIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGS QFFITTVPTPHLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKLCVIAE CGELKEGDDGGIFPKDGSGDSHPDFPEDADIDLKDVDKILLITEDLKNIG NTFFKSQNWEMAIKKYAEVLRYVDSSKAVIETADRAKLQPIALSCVLNIG ACKLKMSNWQGAIDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADL KKAQGIAPEDKAIQAELLKVKQKIKAQKDKEKAVYAKMFA

Specifications

Our Abpromise guarantee covers the use of ab78815 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, PBS, pH 7.4

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • 40 kDa peptidyl prolyl cis trans isomerase
    • 40 kDa peptidyl prolyl cis trans isomerase D
    • 40 kDa peptidyl-prolyl cis-trans isomerase
    • Cyclophilin D
    • Cyclophilin related protein
    • Cyclophilin-40
    • Cyclophilin-related protein
    • Cyclophilin40
    • CyclophilinD
    • CYP 40
    • CYP-40
    • CYP40
    • CYPD
    • MGC33096
    • Peptidyl Prolyl Isomerase D
    • Peptidyl-prolyl cis-trans isomerase D
    • Peptidylprolyl isomerase D
    • PPIase
    • PPIase D
    • Ppid
    • PPID_HUMAN
    • Rotamase
    • Rotamase D
    see all
  • Function

    PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the cyclophilin-type PPIase family. PPIase D subfamily.
    Contains 1 PPIase cyclophilin-type domain.
    Contains 3 TPR repeats.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

References

ab78815 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab78815.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up