Recombinant Human Cyclophilin 40 protein (BSA and azide free) (ab173064)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSHPSPQAKPSNPSNPRVFFDVDIGGERVG RIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKGCPFHRIIKKF MIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGS QFFITTVPTPHLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKLCVIAE CGELKEGDDGGIFPKDGSGDSHPDFPEDADIDLKDVDKILLITEDLKNIG NTFFKSQNWEMAIKKYAEVLRYVDSSKAVIETADRAKLQPIALSCVLNIG ACKLKMSNWQGAIDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADL KKAQGIAPEDKAIQAELLKVKQKIKAQKDKEKAVYAKMFA VEHHHHHH
    • Molecular weight
      41 kDa
    • Amino acids
      2 to 370
    • Tags
      His tag C-Terminus , His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab173064 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituent: 100% PBS

    Supplied as a 0.2 µM filtered solution

General Info

  • Alternative names
    • 40 kDa peptidyl prolyl cis trans isomerase
    • 40 kDa peptidyl prolyl cis trans isomerase D
    • 40 kDa peptidyl-prolyl cis-trans isomerase
    • Cyclophilin D
    • Cyclophilin related protein
    • Cyclophilin-40
    • Cyclophilin-related protein
    • Cyclophilin40
    • CyclophilinD
    • CYP 40
    • CYP-40
    • CYP40
    • CYPD
    • MGC33096
    • Peptidyl Prolyl Isomerase D
    • Peptidyl-prolyl cis-trans isomerase D
    • Peptidylprolyl isomerase D
    • PPIase
    • PPIase D
    • Ppid
    • PPID_HUMAN
    • Rotamase
    • Rotamase D
    see all
  • Function
    PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the cyclophilin-type PPIase family. PPIase D subfamily.
    Contains 1 PPIase cyclophilin-type domain.
    Contains 3 TPR repeats.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab173064 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173064.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up