Recombinant Human CYFIP1 protein (ab153207)

Overview

  • Product name

    Recombinant Human CYFIP1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      GATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSLELAI GRFESEDLTSIVELDGLLEINRMTHKLLSRYLTLD
    • Amino acids

      735 to 819
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153207 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CY
    • CYFIP 1
    • CYFIP1
    • CYFP1_HUMAN
    • Cytoplasmic FMR1 interacting protein 1
    • Cytoplasmic FMR1-interacting protein 1
    • FLJ45151
    • KIAA0068
    • p140sra 1
    • p140sra-1
    • P140SRA1
    • Selective hybridizing clone
    • SHYC
    • Specifically Rac1 associated protein 1
    • Specifically Rac1-associated protein 1
    • SRA 1
    • Sra-1
    • SRA1
    see all
  • Function

    Component of the CYFIP1-EIF4E-FMR1 complex which binds to the mRNA cap and mediates translational repression. In the CYFIP1-EIF4E-FMR1 complex this subunit is an adapter between EIF4E and FMR1. Promotes the translation repression activity of FMR1 in brain probably by mediating its association with EIF4E and mRNA (By similarity). Involved in formation of membrane ruffles and lamellipodia protrusions and in axon outgrowth. Binds to F-actin but not to RNA. Regulator of epithelial morphogenesis. May act as an invasion suppressor in cancers.
  • Sequence similarities

    Belongs to the CYFIP family.
  • Cellular localization

    Cytoplasm > perinuclear region. Cell projection > lamellipodium. Cell projection > ruffle. Cell junction > synapse > synaptosome. Highly expressed in the perinuclear region. Enriched in synaptosomes, membrane ruffles and at the tips of lamellipodia.
  • Information by UniProt

Images

  • ab153207 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153207 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153207.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up