Overview

  • Product name
    Recombinant Human Cylicin 1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SSKTGFKTSTKIKGSDTESEESLYKPGAKKKIDESDGTSANSKMEGLESK RGFRMSSKKTTFNEKGEKASTGRVPPSREKPPLPACEPSLPSPKVRRLCW
    • Amino acids
      526 to 625
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158243 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CYCL1
    • CYLC1
    • CYLC1_HUMAN
    • Cylicin I
    • Cylicin, basic protein of sperm head cytoskeleton 1
    • Cylicin-1
    • Multiple band polypeptide I
    • Multiple-band polypeptide I
    • OTTHUMP00000023617
    see all
  • Function
    Possible architectural role during spermatogenesis. May be involved in spermatid differentiation.
  • Tissue specificity
    Testis.
  • Developmental stage
    Specific to late spermatogenesis.
  • Cellular localization
    Cytoplasm > cytoskeleton > perinuclear theca > calyx. Sperm head cytoskeletal structure.
  • Information by UniProt

Images

  • ab158243 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158243 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158243.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up