Overview

  • Product name

    Recombinant Human CYP11A1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MLAKGLPPRSVLVKGCQTFLSAPREGLGRLRVPTGEGAGISTRSPRPFNE IPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVY VIDPEDVALLFKSEGPNPERFLIPPWVAYHQYYQRPIGVLLKKSAAWKKD RVALNQEVMAPEATKNFLPLLDAVSRDFVSVLHRRIKKAGSGNYSGDISD DLFRFAFESITNVIFGERQGMLEEVVNPEAQRFIDAIYQMFHTSVPMLNL PPDLFRLFRTKTWKDHVAAWDVIFSKADIYTQNFYWELRQKGSVHHDYRG ILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQWHLYEMARNLKVQD MLRAEVLAARHQAQGDMATMLQLVPLLKASIKETLRLHPISVTLQRYLVN DLVLRDYMIPAKTLVQVAIYALGREPTFFFDPENFDPTRWLSKDKNITYF RNLGFGWGVRQCLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLI LMPEKPISFTFWPFNQEATQQ
    • Molecular weight

      87 kDa including tags
    • Amino acids

      1 to 521
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab132669 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cholesterol 20 22 desmolase
    • Cholesterol desmolase
    • Cholesterol monooxygenase (side chain cleaving)
    • Cholesterol side chain cleavage enzyme
    • Cholesterol side chain cleavage enzyme mitochondrial
    • Cholesterol side-chain cleavage enzyme
    • CP11A_HUMAN
    • CYP11A
    • CYP11A1
    • CYPXIA1
    • Cytochrome P450 11A1
    • Cytochrome P450 11A1 mitochondrial
    • Cytochrome P450 family 11 subfamily A polypeptide 1
    • Cytochrome P450 subfamily XIA
    • Cytochrome P450(scc)
    • Cytochrome P450C11A1
    • mitochondrial
    • P450SCC
    • Steroid 20 22 lyase
    see all
  • Function

    Catalyzes the side-chain cleavage reaction of cholesterol to pregnenolone.
  • Pathway

    Lipid metabolism; C21-steroid hormone metabolism.
  • Involvement in disease

    Defects in CYP11A1 are a cause of congenital adrenal insufficiency (CAI).
    Defects in CYP11A1 are a cause of congenital lipoid adrenal hyperplasia (CLAH) [MIM:201710]; also known as lipoid CAH. CLAH is the most severe form of adrenal hyperplasia. This autosomal recessive and potentially lethal condition includes the onset of profound adrenocortical insufficiency shortly after birth, hyperpigmentation reflecting increased production of pro-opiomelanocortin, elevated plasma renin activity as a consequence of reduced aldosterone synthesis, and male pseudohermaphroditism resulting from deficient fetal testicular testosterone synthesis. CLAH is a rare disease, except in Japan and Korea where it accounts for a significant percentage of cases of congenital adrenal hyperplasia.
  • Sequence similarities

    Belongs to the cytochrome P450 family.
  • Cellular localization

    Mitochondrion membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132669 stained with Coomassie Blue

References

ab132669 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132669.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up