Overview

  • Product name

    Recombinant Human CYP11B1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWL RLLQIWREQGYEDLHLEVHQTFQELGPIFRSRHSASFGRWGRSAARAGLW RCQGRGWCRANPSSLQRGQDSEALKYDLGGAGMVCVMLPEDVEKLQQVDS LHPHRMSLEPWVAYRQHRGHKCGVFLLNVADRGNSSPPFPGGIHGAPTHS GCRNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQN ARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEV MFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELA FSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFE LARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVG LFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWL DIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQE DIKMVYSFILRPSMFPLLTFRAIN
    • Amino acids

      1 to 574
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158257 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CPN1
    • CYP11B
    • CYPXIB1
    • Cytochrome P 450c11
    • Cytochrome P450 11B1, mitochondrial
    • Cytochrome p450 XIB1
    • Cytochrome P450, family 11, subfamily B, polypeptide 1
    • Cytochrome P450, subfamily XIB (steroid 11 beta hydroxylase), polypeptide 1
    • Cytochrome P450, subfamily XIB, polypeptide 1
    • Cytochrome P450C11
    • FHI
    • P 450C11
    • P450C11
    • S11BH
    • Steroid 11 beta hydroxylase
    • Steroid 11 beta monooxygenase
    see all
  • Relevance

    This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and has steroid 11-beta-hydroxylase activity. In addition to this activity, the 18 or 19-hydroxylation of steroids and the aromatization of androstendione to estrone have also been ascribed to cytochrome P450 XIB. Defects in CYP11B1 are the cause of adrenal hyperplasia type 4 (AH4) [MIM:202010]. AH4 is a form of congenital adrenal hyperplasia, a common recessive disease due to defective synthesis of cortisol. Congenital adrenal hyperplasia is characterized by androgen excess leading to ambiguous genitalia in affected females, rapid somatic growth during childhood in both sexes with premature closure of the epiphyses and short adult stature. Four clinical types: "salt wasting" (SW, the most severe type), "simple virilizing" (SV, less severely affected patients), with normal aldosterone biosynthesis, "non-classic form" or late onset (NC or LOAH), and "cryptic" (asymptomatic). AH4 patients usually have hypertension.
  • Cellular localization

    Mitochondrion inner membrane.

Images

  • ab158257 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158257 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158257.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up