Description

  • Product name

    Recombinant Human CYP27A1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAALGCARLRWALRGAGRGLCPHGARAKAAIPAALPSDKATGAPGAGPGV RRRQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYL GPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTE GHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLDQLRAESASGN QVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQN SLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAA GPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYH LSKDPEIQEALHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVV PTNSRIIEKEIEVDGFLFPKNTQFVFCHYVVSRDPTAFSEPESFQPHRWL RNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVV LAPETGELKSVARIVLVPNKKVGLQFLQRQC
    • Amino acids

      1 to 531
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158258 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 12-alpha-triol 27-hydroxylase
    • 5-beta-cholestane-3-alpha
    • 5-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 26-hydroxylase
    • 5-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 27-hydroxylase
    • 5-beta-cholestane-3-alpha,7-alpha,12-alpha-triol 27-hydroxylase
    • 7-alpha
    • Cholestanetriol 26 monooxygenase
    • CP27
    • CP27A_HUMAN
    • CTX
    • CYP
    • CYP27
    • CYP27A1
    • Cytochrome P 450C27/25
    • Cytochrome P-450C27/25
    • Cytochrome P450 27
    • Cytochrome P450 27 mitochondrial
    • Cytochrome P450 family 27 subfamily A member 1
    • Cytochrome P450 family 27 subfamily A polypeptide 1
    • Cytochrome P450 subfamily XXVIIA (steroid 27-hydroxylase cerebrotendinous xanthomatosis) polypeptide 1
    • mitochondrial
    • Sterol 26 hydroxylase
    • Sterol 26 hydroxylase mitochondrial
    • Sterol 26-hydroxylase
    • Sterol 27 hydroxylase
    • Sterol 27-hydroxylase
    • Vitamin D(3) 25 hydroxylase
    • Vitamin D(3) 25-hydroxylase
    see all
  • Function

    Catalyzes the first step in the oxidation of the side chain of sterol intermediates; the 27-hydroxylation of 5-beta-cholestane-3-alpha,7-alpha,12-alpha-triol. Has also a vitamin D3-25-hydroxylase activity.
  • Pathway

    Hormone biosynthesis; cholecalciferol biosynthesis.
  • Involvement in disease

    Cerebrotendinous xanthomatosis
  • Sequence similarities

    Belongs to the cytochrome P450 family.
  • Cellular localization

    Mitochondrion membrane.
  • Information by UniProt

Images

  • ab158258 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158258 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158258.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up