Description

  • Product name

    Recombinant Human CYP2A6 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LGSVLRDPSFFSNPQDFNPQHFLNEKGQFKKSDAFVPFSIGKRNCFGEGL ARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVGFATIPRNYTMSFLPR
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      395 to 494

Specifications

Our Abpromise guarantee covers the use of ab114776 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.

     This product was previously labelled as Cytochrome P450 2A6

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Coumarin 7 hydroxylase
    • Coumarin 7-hydroxylase
    • CP2A6_HUMAN
    • CPA6
    • CYP2A
    • CYP2A3
    • CYP2A6
    • CYPIIA6
    • Cytochrome P450 2A6
    • Cytochrome P450 IIA3
    • Cytochrome P450 subfamily IIA (phenobarbital inducible) polypeptide 6
    • Cytochrome P450(I)
    • Cytochrome P450, family 2 subfamily A polypeptide 6
    • Flavoprotein linked monooxygenase
    • P450C2A
    • P450PB
    • Xenobiotic monooxygenase
    see all
  • Function

    Exhibits a high coumarin 7-hydroxylase activity. Can act in the hydroxylation of the anti-cancer drugs cyclophosphamide and ifosphamide. Competent in the metabolic activation of aflatoxin B1. Constitutes the major nicotine C-oxidase. Possesses low phenacetin O-deethylation activity.
  • Tissue specificity

    Liver.
  • Sequence similarities

    Belongs to the cytochrome P450 family.
  • Cellular localization

    Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt

Images

  • ab114776 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114776 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114776.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up