Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDM SKSLTNFSKVYGPVFTVYFGLKPIVVLHGYEAVKEALIDHGEEFSGRGSF PVAEKVNKGLGILFSNGKRWKEIRRFCLMTLRNFGMGKRSIEDRVQEEAR CLVEELRKTNASPCDPTFILGCAPCNVICSVIFHDRFDYKDQRFLNLMEK FNENLRILSSPWIQVCNNFPALIDYLPGSHNKIAENFAYIKSYVLERIKE HQESLDMNSARDFIDCFLIKMEQEKHNQQSEFTVESLIATVTDMFGAGTE TTSTTLRYGLLLLLKYPEVTAKVQEEIECVVGRNRSPCMQDRSHMPYTDA VVHEIQRYIDLLPTNLPHAVTCDVKFKNYLIPKGTTIITSLTSVLHNDKE FPNPEMFDPGHFLDKSGNFKKSDYFMPFSAGKRMCMGEGLARMELFLFLT TILQNFNLKSQVDPKDIDITPIANAFGRVPPLYQLCFIPV
    • Amino acids
      1 to 490
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158251 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • (S) mephenytoin hydroxylase associated cytochrome P450
    • CPCI
    • CYP2C
    • CYP2C 18
    • CYP2C17
    • CYPIIC18
    • Cytochrome P450 2C18
    • Cytochrome P450 6B/29C
    • Cytochrome P450 family 2 subfamily C polypeptide 18
    • Cytochrome P450 subfamily IIC (mephenytoin 4 hydroxylase) polypeptide 17
    • Cytochrome P450 subfamily IIC (mephenytoin 4 hydroxylase) polypeptide 18
    • Flavoprotein linked monooxygenase
    • Microsomal monooxygenase
    • P450 6B/29C
    • P450IIC17
    • Unspecific monooxygenase
    see all
  • Relevance
    CYP2C18 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. CYP2C18 oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
  • Cellular localization
    Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein.

Images

  • ab158251 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158251 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158251.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up