Overview

  • Product name

    Recombinant Human CYP2J2 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      LHRDPTEWATPDTFNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTE LFIFFTSLMQKFTFRPPNNEKLSLKFRMGITISPVSHRLCA
    • Amino acids

      408 to 498
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158256 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as Cytochrome p450 2J2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Arachidonic acid epoxygenase
    • CP2J2_HUMAN
    • CPJ2
    • CYP2J2
    • CYPIIJ2
    • Cytochrome P450 2J2
    • Cytochrome P450 family 2 subfamily J polypeptide 2
    • Cytochrome P450 subfamily IIJ (arachidonic acid epoxygenase) polypeptide 2
    • Cytochrome P450 subfamily IIJ polypeptide 2
    • Flavoprotein linked monooxygenase
    • Microsomal monooxygenase
    • OTTHUMP00000010550
    see all
  • Function

    This enzyme metabolizes arachidonic acid predominantly via a NADPH-dependent olefin epoxidation to all four regioisomeric cis-epoxyeicosatrienoic acids. One of the predominant enzymes responsible for the epoxidation of endogenous cardiac arachidonic acid pools.
  • Tissue specificity

    Highly expressed in heart, present at lower levels in liver, ileum, jejunum, colon, and kidney.
  • Sequence similarities

    Belongs to the cytochrome P450 family.
  • Cellular localization

    Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt

Images

  • ab158256 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158256 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158256.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up