Description

  • Product name

    Recombinant Human CYP2U1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSSPGPSQPPAEDPPWPARLLRAPLGLLRLDPSGGALLLCGLVALLGWSW LRRRRARGIPPGPTPWPLVGNFGHVLLPPFLRRRSWLSSRTRAAGIDPSV IGPQVLLAHLARVYGSIFSFFIGHYLVVVLSDFHSVREALVQQAEVFSDR PRVPLISIVTKEKELFQE
    • Amino acids

      1 to 168
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165008 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CP2U1_HUMAN
    • CYP2U 1
    • CYP2U1
    • Cytochrome P450 2U1
    • Cytochrome P450, family 2, subfamily U, polypeptide 1
    • EC 1.14.14.1
    • P450TEC
    see all
  • Function

    Catalyzes the hydroxylation of arachidonic acid, docosahexaenoic acid and other long chain fatty acids. May modulate the arachidonic acid signaling pathway and play a role in other fatty acid signaling processes.
  • Tissue specificity

    Widely expressed with stronger expression in thymus, heart and cerebellum.
  • Sequence similarities

    Belongs to the cytochrome P450 family.
  • Developmental stage

    Expressed in fetal thymus.
  • Cellular localization

    Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt

Images

  • ab165008 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165008 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165008.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up