Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDLIPNLAVETWLLLAVSLILLYLYGTRTHGLFKKLGIPGPTPLPFLGNA LSFRKGYWTFDMECYKKYRKVWGIYDCQQPMLAITDPDMIKTVLVKECYS VFTNRRPFGPVGFMKNAISIAEDEEWKRIRSLLSPTFTSGKLKEMVPIIA QYGDVLVRNLRREAETGKPVTLKHVFGAYSMDVITSTSFGVSIDSLNNPQ DPFVENTKKLLRFNPLDPFVLSIKVFPFLTPILEALNITVFPRKVISFLT KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI IFIFAGYETTSSVLSFIIYELATHPDVQQKVQKEIDTVLPNKAPPTYDTV LQLEYLDMVVNETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYV LHHDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALV NMKLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRDETV SGA
    • Molecular weight

      84 kDa including tags
    • Amino acids

      1 to 503
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152315 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Purity

    > 99 % Proprietary Purification.

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Aryl hydrocarbon hydroxylase
    • CP37
    • CP3A7_HUMAN
    • CYP3A7
    • CYPIIIA7
    • Cytochrome P450 3A7
    • Cytochrome P450, family 3, subfamily A, polypeptide 7
    • Cytochrome P450, subfamily IIIA, polypeptide 7
    • Cytochrome P450-HFLA
    • Flavoprotein linked monooxygenase
    • Microsomal monooxygenase
    • P 450(HFL33)
    • P 450111A7
    • P450 HFLA
    • Xenobiotic monooxygenase
    see all
  • Function

    Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
  • Sequence similarities

    Belongs to the cytochrome P450 family.
  • Cellular localization

    Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152315 stained with Coomassie Blue.

References

ab152315 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152315.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up