Overview

  • Product name

    Recombinant Human CYP46A1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      TSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFL RQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFF
    • Amino acids

      201 to 300
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161176 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as CYP46

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cholesterol 24-hydroxylase
    • CP46
    • CYP46
    • CYP46A1
    • cytochrome P450 family 46
    see all
  • Relevance

    The Cyp46 gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein is expressed exclusively in the brain, where it converts cholesterol to 24S-hydroxycholesterol by adding a hydroxyl group to cholesterol, producing a product that is more soluble than cholesterol and able to be exported from the brain. Cyp46 is also known as 24S-cholesterol hydroxylase
  • Cellular localization

    Endoplasmic reticulum

Images

  • ab161176 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161176 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161176.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up