Overview

  • Product name
    Recombinant Human CYP51A1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SPTVNQRLKDSWVERLDFNPDRYLQDNPASGEKFAYVPFGAGRHRCIGEN FAYVQIKTIWSTMLRLYEFDLIDGYFPTVNYTTMIHTPENPVIRYKRRSK
    • Amino acids
      410 to 509
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158260 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CP51
    • CP51A_HUMAN
    • CYP51
    • CYP51A1
    • CYPL1
    • CYPLI
    • Cytochrome P450 51
    • Cytochrome P450 51A1
    • Cytochrome P450 family 51 subfamily A member 1
    • Cytochrome P450 family 51 subfamily A polypeptide 1
    • Cytochrome P450, 51 (lanosterol 14 alpha demethylase)
    • Cytochrome P450-14DM
    • Cytochrome P45014DM
    • Cytochrome P450LI
    • Lanosterol 14-alpha demethylase
    • LDM
    • P450 14DM
    • P450L1
    • Sterol 14-alpha demethylase
    see all
  • Function
    Catalyzes C14-demethylation of lanosterol; it transforms lanosterol into 4,4'-dimethyl cholesta-8,14,24-triene-3-beta-ol.
  • Tissue specificity
    Ubiquitously expressed with highest levels in testis, ovary, adrenal, prostate, liver, kidney and lung.
  • Pathway
    Steroid biosynthesis; zymosterol biosynthesis; zymosterol from lanosterol: step 1/6.
  • Sequence similarities
    Belongs to the cytochrome P450 family.
  • Cellular localization
    Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt

Images

  • ab158260 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158260 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158260.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up