Description

  • Product name

    Recombinant Human CYR61/CCN1 protein (His tag)
    See all CYR61/CCN1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      TCPAACHCPLEAPKCAPGVGLVRDGCGCCKVCAKQLNEDCSKTQPCDHTK GLECNFGASSTALKGICRAQSEGRPCEYNSRIYQNGESFQPNCKHQCTCI DGAVGCIPLCPQELSLPNLGCPNPRLVKVTGQCCEEWVCDEDSIKDPMED QDGLLGKELGFDASEVELTRNNELIAVGKGSSLKRLPVFGMEPRILYNPL QGQKCIVQTTSWSQCSKTCGTGISTRVTNDNPECRLVKETRICEVRPCGQ PVYSSLKKGKKCSKTKKSPEPVRFTYAGCLSVKKYRPKYCGSCVDGRCCT PQLTRTVKMRFRCEDGETFSKNVMMIQSCKCNYNCPHANEAAFPFYRLFN DIHKFRD
    • Predicted molecular weight

      55 kDa including tags
    • Amino acids

      25 to 381
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Mature chain lacking the signal peptide. N-terminal 6xHis-SUMO-tagged.

Specifications

Our Abpromise guarantee covers the use of ab235689 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • 3CH61
    • CCN 1
    • CCN family member 1
    • CCN1
    • CYR 61
    • Cyr61
    • CYR61 protein
    • CYR61_HUMAN
    • Cysteine rich angiogenic inducer 61
    • Cysteine rich heparin binding protein 61
    • Cysteine-rich angiogenic inducer 61
    • GIG 1
    • GIG1
    • IBP-10
    • IGF-binding protein 10
    • Igfbp 10
    • IGFBP-10
    • Igfbp10
    • Insulin like growth factor binding protein 10
    • Insulin-like growth factor-binding protein 10
    • Protein CYR61
    • Protein GIG1
    see all
  • Function

    Promotes cell proliferation, chemotaxis, angiogenesis and cell adhesion. Appears to play a role in wound healing by up-regulating, in skin fibroblasts, the expression of a number of genes involved in angiogenesis, inflammation and matrix remodeling including VEGA-A, VEGA-C, MMP1, MMP3, TIMP1, uPA, PAI-1 and integrins alpha-3 and alpha-5. CYR61-mediated gene regulation is dependent on heparin-binding. Down-regulates the expression of alpha-1 and alpha-2 subunits of collagen type-1. Promotes cell adhesion and adhesive signaling through integrin alpha-6/beta-1, cell migration through integrin alpha-v/beta-5 and cell proliferation through integrin alpha-v/beta-3.
  • Sequence similarities

    Belongs to the CCN family.
    Contains 1 CTCK (C-terminal cystine knot-like) domain.
    Contains 1 IGFBP N-terminal domain.
    Contains 1 TSP type-1 domain.
    Contains 1 VWFC domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • ab235689 analyzed by (tris-glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab235689 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235689.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up