Description

  • Product name

    Recombinant human Cystatin-B protein
  • Biological activity

    The IC50 value is < 3.0nM. The inhibitory function of Stefin B on protease activity of papain was measured by a fluorometric assay using Z-FR-AMC at pH 7.5 at 25°C.

  • Purity

    > 95 % SDS-PAGE.
    ab211315 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMMCGAPSATQPATAETQHIADQVRSQLEEK ENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPL TLSNYQTNKAKHDELTYF
    • Predicted molecular weight

      13 kDa including tags
    • Amino acids

      1 to 98
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_000091.

Specifications

Our Abpromise guarantee covers the use of ab211315 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    Functional Studies

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Stefin B

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 0.29% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • CHROW21
    • CPI B
    • CPI-B
    • CST 6
    • CST6
    • CSTB
    • Cystatin B
    • Cystatin B (stefin B)
    • Cystatin-B
    • CYTB
    • CYTB_HUMAN
    • EPM1
    • EPM1A
    • Liver thiol proteinase inhibitor
    • PME
    • Stefin-B
    • STF B
    • STFB
    • ULD
    see all
  • Function

    This is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B.
  • Involvement in disease

    Defects in CSTB are the cause of progressive myoclonic epilepsy type 1 (EPM1) [MIM:254800]. EPM1 is an autosomal recessive disorder characterized by severe, stimulus-sensitive myoclonus and tonic-clonic seizures. The onset, occurring between 6 and 13 years of age, is characterized by convulsions. Myoclonus begins 1 to 5 years later. The twitchings occur predominantly in the proximal muscles of the extremities and are bilaterally symmetrical, although asynchronous. At first small, they become late in the clinical course so violent that the victim is thrown to the floor. Mental deterioration and eventually dementia develop.
  • Sequence similarities

    Belongs to the cystatin family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab211315 (3µg).

References

ab211315 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211315.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up