Recombinant human Cystatin C protein (ab140738)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Active: Yes
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, MS
Description
-
Product name
Recombinant human Cystatin C protein
See all Cystatin C proteins and peptides -
Biological activity
The IC50 value is < 2.0 nM. The inhibitory function of Cystatin C on protease activity of papain was measured by a fluorometric assay using Z-FR-AMC at pH 7.5 at 25°C.
-
Purity
> 95 % SDS-PAGE.
ab140738 was purified using conventional chromatography techniques. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMSSPGKPPRLVGGPMDASVEEEGVRRALDF AVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPN LDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA -
Predicted molecular weight
16 kDa including tags -
Amino acids
27 to 146 -
Tags
His tag N-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab140738 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Mass Spectrometry
-
Mass spectrometry
MALDI-TOF -
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.32% Tris HCl, 20% Glycerol (glycerin, glycerine), 0.58% Sodium chlorideThis product is an active protein and may elicit a biological response in vivo, handle with caution.
General Info
-
Alternative names
- AD 8
- AD8
- Amyloid angiopathy and cerebral hemorrhage
see all -
Function
As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity. -
Tissue specificity
Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in various body fluids, such as the cerebrospinal fluid and plasma. Expressed in highest levels in the epididymis, vas deferens, brain, thymus, and ovary and the lowest in the submandibular gland. -
Involvement in disease
Amyloidosis 6
Macular degeneration, age-related, 11 -
Sequence similarities
Belongs to the cystatin family. -
Post-translational
modificationsThe Thr-25 variant is O-glycosylated with a core 1 or possibly core 8 glycan. The signal peptide of the O-glycosylated Thr-25 variant is cleaved between Ala-20 and Val-21. -
Cellular localization
Secreted. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab140738 has not yet been referenced specifically in any publications.