Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSSPGKPPRLVGGPMDASVEEEGVRRALDF AVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPN LDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
    • Molecular weight

      16 kDa including tags
    • Amino acids

      27 to 146
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab140738 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The IC50 value is < 2.0 nM. The inhibitory function of Cystatin C on protease activity of papain was measured by a fluorometric assay using Z-FR-AMC at pH 7.5 at 25°C.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 95 % SDS-PAGE.
    ab140738 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • AD 8
    • AD8
    • Amyloid angiopathy and cerebral hemorrhage
    • ARMD11
    • bA218C14.4
    • bA218C14.4 (cystatin C)
    • Cst 3
    • Cst3
    • CST3 protein
    • Cystatin 3
    • Cystatin-3
    • Cystatin-C
    • Cystatin3
    • CystatinC
    • CYTC_HUMAN
    • Epididymis secretory protein Li 2
    • Gamma trace
    • Gamma-trace
    • HCCAA
    • HEL S 2
    • MGC117328
    • Neuroendocrine basic polypeptide
    • Post gamma globulin
    • Post-gamma-globulin
    see all
  • Function

    As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity.
  • Tissue specificity

    Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in various body fluids, such as the cerebrospinal fluid and plasma. Expressed in highest levels in the epididymis, vas deferens, brain, thymus, and ovary and the lowest in the submandibular gland.
  • Involvement in disease

    Amyloidosis 6
    Macular degeneration, age-related, 11
  • Sequence similarities

    Belongs to the cystatin family.
  • Post-translational
    modifications

    The Thr-25 variant is O-glycosylated with a core 1 or possibly core 8 glycan. The signal peptide of the O-glycosylated Thr-25 variant is cleaved between Ala-20 and Val-21.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab140738 (3µg).

References

ab140738 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab140738.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up